CPHXL (cytoplasmic polyadenylated homeobox like)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 105371346
Gene name Cytoplasmic polyadenylated homeobox like
Gene symbol CPHXL
Synonyms (NCBI Gene)
CPHXL1
Chromosome 16
Chromosome location 16q23.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
618700 51815 ENSG00000283755
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1W2PPM1
Protein name Cytoplasmic polyadenylated homeobox-like protein (Cytoplasmic polyadenylated homeobox 1)
Protein function Transcription factor that acts as activator.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 29 → 83 Homeodomain Domain
Sequence 
MNLDGTSGGFPAEEDHHNEERQTKNKRKTKHRHKFSEELLQELKEIFGENCYPDYTTRKT
LAIKFDCPVNVIDNWFQNKRARLPPAERRRIFVLQKKHDFPVQAHSFLSCQETQAAAHNY
ATKQSLSGAQRALMRRAGCSHLEKQWIPSQEMGYNCFSLENQETPSQQVGPQCSYLEKPG
IPSQQVGSQCSYLEKLGIPSQQVASQSSYLVTGTEKHPGCAMGYGGDTGSGHSGSGHSTA
YHFLSYNSAECLHPPPSSVPYFHGERTETKESQHASPFLLDYAQGAYGVKKDHCLCSFCL
SLLGQQQQNDWQYHLQQHQQPQNYLEGMMLQEQLPMDSGPWDLGKQWSSAQSQLQSQLPQ
NNGKPLCSQLQHMSLQIAADSPLLPLGQDMQERASEQPRTQMQQL
Sequence length 405
Interactions View interactions

No strongly related genes found yet for CPHXL.

No additional diseases found yet through genes similar to CPHXL.