CPB1 (carboxypeptidase B1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 1360
Gene name Carboxypeptidase B1
Gene symbol CPB1
Synonyms (NCBI Gene)
CPBPASPPCPB
Chromosome 3
Chromosome location 3q24
Summary Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marke
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT2204438 hsa-miR-4795-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17 Show/Hide all (17)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004180 Function Carboxypeptidase activity IDA 1370825
GO:0004180 Function Carboxypeptidase activity IEA
GO:0004180 Function Carboxypeptidase activity TAS 1370825
GO:0004181 Function Metallocarboxypeptidase activity IBA
GO:0004181 Function Metallocarboxypeptidase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
114852 2299 ENSG00000153002
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P15086
Protein name Carboxypeptidase B (EC 3.4.17.2) (Pancreas-specific protein) (PASP)
PDB 1KWM , 1ZLI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00246 Peptidase_M14 125 → 404 Zinc carboxypeptidase Domain
PF02244 Propep_M14 28 → 104 Carboxypeptidase activation peptide Domain
Tissue specificity TISSUE SPECIFICITY: Pancreas. {ECO:0000269|PubMed:2920728}.
Sequence 
MLALLVLVTVALASAHHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQ
IKPHSTVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYN
KWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVLPVLNIDGYIYTWTKSRFWRKTRSTH
TGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAY
LTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLY
Sequence length 417
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Pancreatic secretion Metabolism of Angiotensinogen to Angiotensins
Protein digestion and absorption  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Acute myeloid leukemia Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CPB1-related disorder Likely benign; Benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (40)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute pancreatitis Pancreatitis BEFREE 1370825
★★★★★
★☆☆☆☆
Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA Syndromic microphthalmia BEFREE 29631213
★★★★★
★☆☆☆☆
Found in Text Mining only
Aphakia, congenital primary Congenital primary aphakia BEFREE 29649772
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 21804193
★★★★★
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial Fibrillation BEFREE 31515731
★★★★★
★☆☆☆☆
Found in Text Mining only
Atypical Hemolytic Uremic Syndrome Hemolytic Uremic Syndrome BEFREE 19625716
★★★★★
★☆☆☆☆
Found in Text Mining only
Blood Coagulation Disorders Blood Coagulation Disorders BEFREE 31694568
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 25903579
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 25903579 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Pancreatic ductal carcinoma Pubtator 31731384, 35171259 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
CPA3 3 shared pathwaysPancreatic secretion, Protein digestion and absorption, Metabolism of Angiotensinogen to Angiotensins Related via 3 shared pathways including Pancreatic secretion, Protein digestion and absorption. CELA3A 2 shared pathwaysPancreatic secretion, Protein digestion and absorption Related via 2 shared pathways including Pancreatic secretion, Protein digestion and absorption. CPA1 2 shared pathwaysPancreatic secretion, Protein digestion and absorption Related via 2 shared pathways including Pancreatic secretion, Protein digestion and absorption. CPA2 2 shared pathwaysPancreatic secretion, Protein digestion and absorption Related via 2 shared pathways including Pancreatic secretion, Protein digestion and absorption. CTRL 2 shared pathwaysPancreatic secretion, Protein digestion and absorption Related via 2 shared pathways including Pancreatic secretion, Protein digestion and absorption.
Diverticular disease Linked via 1 of 5 related genesCPA3 Dyslexia Linked via 1 of 5 related genesCPA3 Hypertension Linked via 1 of 5 related genesCPA3 Uterine fibroid Linked via 1 of 5 related genesCELA3A Hereditary chronic pancreatitis Linked via 1 of 5 related genesCPA1