Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	56901
Gene name	Cytochrome c oxidase hypoxia associated subunit FA4L2
Gene symbol	COXFA4L2
Synonyms (NCBI Gene)	MISTRHNDUFA4L2NUOMS
Chromosome	12
Chromosome location	12q13.3

45 Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017521	hsa-miR-335-5p	Microarray	18185580
MIRT1178777	hsa-miR-1285	CLIP-seq
MIRT1178778	hsa-miR-1291	CLIP-seq
MIRT1178779	hsa-miR-1321	CLIP-seq
MIRT1178780	hsa-miR-2053	CLIP-seq
MIRT1178781	hsa-miR-3187-5p	CLIP-seq
MIRT1178782	hsa-miR-3619-3p	CLIP-seq
MIRT1178783	hsa-miR-3646	CLIP-seq
MIRT1178784	hsa-miR-3690	CLIP-seq
MIRT1178785	hsa-miR-4308	CLIP-seq
MIRT1178786	hsa-miR-4690-3p	CLIP-seq
MIRT1178787	hsa-miR-4728-5p	CLIP-seq
MIRT1178788	hsa-miR-4739	CLIP-seq
MIRT1178789	hsa-miR-4756-5p	CLIP-seq
MIRT1178790	hsa-miR-4776-5p	CLIP-seq
MIRT1178791	hsa-miR-612	CLIP-seq
MIRT1178792	hsa-miR-661	CLIP-seq
MIRT1178793	hsa-miR-939	CLIP-seq
MIRT1178777	hsa-miR-1285	CLIP-seq
MIRT1178778	hsa-miR-1291	CLIP-seq
MIRT1178781	hsa-miR-3187-5p	CLIP-seq
MIRT1178782	hsa-miR-3619-3p	CLIP-seq
MIRT1178784	hsa-miR-3690	CLIP-seq
MIRT1178785	hsa-miR-4308	CLIP-seq
MIRT1178790	hsa-miR-4776-5p	CLIP-seq
MIRT1178791	hsa-miR-612	CLIP-seq
MIRT1178792	hsa-miR-661	CLIP-seq
MIRT1178777	hsa-miR-1285	CLIP-seq
MIRT1178778	hsa-miR-1291	CLIP-seq
MIRT1178781	hsa-miR-3187-5p	CLIP-seq
MIRT1178782	hsa-miR-3619-3p	CLIP-seq
MIRT1178784	hsa-miR-3690	CLIP-seq
MIRT1178785	hsa-miR-4308	CLIP-seq
MIRT1178790	hsa-miR-4776-5p	CLIP-seq
MIRT1178791	hsa-miR-612	CLIP-seq
MIRT1178792	hsa-miR-661	CLIP-seq
MIRT1178777	hsa-miR-1285	CLIP-seq
MIRT1178778	hsa-miR-1291	CLIP-seq
MIRT1178781	hsa-miR-3187-5p	CLIP-seq
MIRT1178782	hsa-miR-3619-3p	CLIP-seq
MIRT1178784	hsa-miR-3690	CLIP-seq
MIRT1178785	hsa-miR-4308	CLIP-seq
MIRT1178790	hsa-miR-4776-5p	CLIP-seq
MIRT1178791	hsa-miR-612	CLIP-seq
MIRT1178792	hsa-miR-661	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0045277	Component	Respiratory chain complex IV	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9NRX3

Protein name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2 (NADH-ubiquinone oxidoreductase MLRQ subunit homolog) (NUOMS)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06522	B12D	16 → 84	NADH-ubiquinone reductase complex 1 MLRQ subunit	Family

Sequence

MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWN
RLSPNDQYKFLAVSTDYKKLKKDRPDF

Sequence length

Interactions

View interactions

KEGG Pathway
Oxidative phosphorylation
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, RHEUMATOID	—	CTD	19192274	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (20)
Alzheimer Disease	Alzheimer disease	Pubtator	25448601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37558878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31277598, 36369883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30710412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26831905, 27453328, 36722045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27226356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37933010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27453328, 29158991, 30538212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31740659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33066813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26819450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30710412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30710412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26819450, 29158991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26819450, 27226356, 29158991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27453328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27453328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30710412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19192274		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Deprivation	Sleep deprivation	Pubtator	36722045	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with COXFA4L2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for COXFA4L2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to COXFA4L2 (see Related Genes above), that are NOT already directly curated for COXFA4L2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to COXFA4L2.

COXFA4L2 (cytochrome c oxidase hypoxia associated subunit FA4L2)

Bookmark This Gene