COX7A2P2 (cytochrome c oxidase subunit 7A2 pseudogene 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 1348
Gene name Cytochrome c oxidase subunit 7A2 pseudogene 2
Gene symbol COX7A2P2
Synonyms (NCBI Gene)
COX7A3COX7ALCOX7AL2COX7AP2
Chromosome 4
Chromosome location 4q22.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004129 Function Cytochrome-c oxidase activity IBA
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0006119 Process Oxidative phosphorylation IBA
GO:0006123 Process Mitochondrial electron transport, cytochrome c to oxygen IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
123997 2290 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60397
Protein name Putative cytochrome c oxidase subunit 7A3, mitochondrial (Cytochrome c oxidase subunit VIIa 3)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02238 COX7a 26 → 76 Cytochrome c oxidase subunit VII Family
Sequence 
MLWNLLALHQIGQRTISTASHRHFKNKVPEKQKLFQEDDGIPLYLKGGIADALLHRATMI
LTVGGTAYAIYQLAVASFPNKGVTSIIPAITWFTFIQLSMDQKSDK
Sequence length 106
Interactions View interactions

No strongly related genes found yet for COX7A2P2.

No additional diseases found yet through genes similar to COX7A2P2.