CORO6 (coronin 6)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 84940
• Gene name: Coronin 6
• Gene symbol: CORO6
• Synonyms (NCBI Gene): ClipinE
• Chromosome: 17
• Chromosome location: 17q11.2

miRNA Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025915	hsa-miR-7-5p	Microarray	19073608
MIRT738269	hsa-miR-1252	CLIP-seq
MIRT904748	hsa-miR-1275	CLIP-seq
MIRT738271	hsa-miR-339-5p	CLIP-seq
MIRT904749	hsa-miR-34a	CLIP-seq
MIRT904750	hsa-miR-34c-5p	CLIP-seq
MIRT738270	hsa-miR-3978	CLIP-seq
MIRT904751	hsa-miR-4302	CLIP-seq
MIRT904752	hsa-miR-4488	CLIP-seq
MIRT904753	hsa-miR-449a	CLIP-seq
MIRT904754	hsa-miR-449b	CLIP-seq
MIRT904755	hsa-miR-4665-5p	CLIP-seq
MIRT904756	hsa-miR-4697-5p	CLIP-seq
MIRT904757	hsa-miR-486-3p	CLIP-seq
MIRT738269	hsa-miR-1252	CLIP-seq
MIRT738271	hsa-miR-339-5p	CLIP-seq
MIRT738270	hsa-miR-3978	CLIP-seq
MIRT738269	hsa-miR-1252	CLIP-seq
MIRT738271	hsa-miR-339-5p	CLIP-seq
MIRT738270	hsa-miR-3978	CLIP-seq
MIRT738269	hsa-miR-1252	CLIP-seq
MIRT2204138	hsa-miR-3155	CLIP-seq
MIRT2204139	hsa-miR-3155b	CLIP-seq
MIRT2204140	hsa-miR-323b-3p	CLIP-seq
MIRT738271	hsa-miR-339-5p	CLIP-seq
MIRT738270	hsa-miR-3978	CLIP-seq
MIRT2204141	hsa-miR-4258	CLIP-seq
MIRT2204142	hsa-miR-4690-3p	CLIP-seq
MIRT2204143	hsa-miR-484	CLIP-seq

Gene ontology (GO) Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32814053
GO:0007015	Process	Actin filament organization	IBA
GO:0016477	Process	Cell migration	IBA
GO:0030027	Component	Lamellipodium	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IEA
GO:0051129	Process	Negative regulation of cellular component organization	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6QEF8
• Protein name: Coronin-6 (Coronin-like protein E) (Clipin-E)
• PDB: 7KYX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	72 → 110	WD domain, G-beta repeat	Repeat
  PF00400	WD40	121 → 160	WD domain, G-beta repeat	Repeat
  PF08953	DUF1899	4 → 69	Domain of unknown function (DUF1899)	Domain
  PF12894	ANAPC4_WD40	170 → 227	Anaphase-promoting complex subunit 4 WD40 domain	Repeat
  PF16300	WD40_4	344 → 386		Repeat

• Sequence:

  MSRRVVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSSFCAVNPKFLAIIVEAGGGGAFI
  VLPLAKTGRVDKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQIPDYTPMRNI
  TEPIITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDVIHS
  VCWNSNGSLLATTCKDKTLRIIDPRKGQVVAEQARPHEGARPLRAVFTADGKLLSTGFSR
  MSERQLALWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEP
  PFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQD
  DLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPR
  RSQSASDAPLSQQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD

• Sequence length: 472

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Breast ductal adenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	29212778	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21132003		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	35062960	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32934959	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21132003		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21132003		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CORO6.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CORO6.