CORO1B (coronin 1B)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57175
• Gene name: Coronin 1B
• Gene symbol: CORO1B
• Synonyms (NCBI Gene): CORONIN-2
• Chromosome: 11
• Chromosome location: 11q13.2
• Summary: Members of the coronin family, such as CORO1B, are WD repeat-containing actin-binding proteins that regulate cell motility (Cai et al., 2005 [PubMed 16027158]).[supplied by OMIM, Mar 2008]

miRNA Show/Hide all (78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020753	hsa-miR-155-5p	Proteomics	18668040
MIRT025452	hsa-miR-34a-5p	Proteomics	21566225
MIRT038589	hsa-miR-106b-3p	CLASH	23622248
MIRT036781	hsa-miR-760	CLASH	23622248
MIRT904575	hsa-miR-143	CLIP-seq
MIRT904576	hsa-miR-3150b-3p	CLIP-seq
MIRT904577	hsa-miR-3179	CLIP-seq
MIRT904578	hsa-miR-3180	CLIP-seq
MIRT904579	hsa-miR-3180-3p	CLIP-seq
MIRT904580	hsa-miR-3196	CLIP-seq
MIRT904581	hsa-miR-3202	CLIP-seq
MIRT904582	hsa-miR-3915	CLIP-seq
MIRT904583	hsa-miR-3928	CLIP-seq
MIRT904584	hsa-miR-3960	CLIP-seq
MIRT904585	hsa-miR-4467	CLIP-seq
MIRT904586	hsa-miR-4481	CLIP-seq
MIRT904587	hsa-miR-4488	CLIP-seq
MIRT904588	hsa-miR-4691-5p	CLIP-seq
MIRT904589	hsa-miR-4697-5p	CLIP-seq
MIRT904590	hsa-miR-4745-5p	CLIP-seq
MIRT904591	hsa-miR-4747-5p	CLIP-seq
MIRT904592	hsa-miR-4758-5p	CLIP-seq
MIRT904593	hsa-miR-4770	CLIP-seq
MIRT904594	hsa-miR-4784	CLIP-seq
MIRT904595	hsa-miR-493	CLIP-seq
MIRT904596	hsa-miR-658	CLIP-seq
MIRT904597	hsa-miR-765	CLIP-seq
MIRT904598	hsa-miR-873	CLIP-seq
MIRT904599	hsa-miR-1	CLIP-seq
MIRT904575	hsa-miR-143	CLIP-seq
MIRT904600	hsa-miR-206	CLIP-seq
MIRT904601	hsa-miR-3123	CLIP-seq
MIRT904576	hsa-miR-3150b-3p	CLIP-seq
MIRT904577	hsa-miR-3179	CLIP-seq
MIRT904578	hsa-miR-3180	CLIP-seq
MIRT904579	hsa-miR-3180-3p	CLIP-seq
MIRT904580	hsa-miR-3196	CLIP-seq
MIRT904581	hsa-miR-3202	CLIP-seq
MIRT904602	hsa-miR-3647-3p	CLIP-seq
MIRT904603	hsa-miR-3673	CLIP-seq
MIRT904584	hsa-miR-3960	CLIP-seq
MIRT904585	hsa-miR-4467	CLIP-seq
MIRT904586	hsa-miR-4481	CLIP-seq
MIRT904587	hsa-miR-4488	CLIP-seq
MIRT904589	hsa-miR-4697-5p	CLIP-seq
MIRT904590	hsa-miR-4745-5p	CLIP-seq
MIRT904591	hsa-miR-4747-5p	CLIP-seq
MIRT904592	hsa-miR-4758-5p	CLIP-seq
MIRT904593	hsa-miR-4770	CLIP-seq
MIRT904594	hsa-miR-4784	CLIP-seq
MIRT904595	hsa-miR-493	CLIP-seq
MIRT904604	hsa-miR-590-3p	CLIP-seq
MIRT904605	hsa-miR-613	CLIP-seq
MIRT904596	hsa-miR-658	CLIP-seq
MIRT904597	hsa-miR-765	CLIP-seq
MIRT1556194	hsa-miR-661	CLIP-seq
MIRT2204112	hsa-miR-2467-3p	CLIP-seq
MIRT2204113	hsa-miR-4419a	CLIP-seq
MIRT2204114	hsa-miR-4446-3p	CLIP-seq
MIRT2204115	hsa-miR-4468	CLIP-seq
MIRT2204116	hsa-miR-4492	CLIP-seq
MIRT2204117	hsa-miR-4498	CLIP-seq
MIRT2204118	hsa-miR-4505	CLIP-seq
MIRT2204119	hsa-miR-4510	CLIP-seq
MIRT904588	hsa-miR-4691-5p	CLIP-seq
MIRT2204120	hsa-miR-4721	CLIP-seq
MIRT2204121	hsa-miR-762	CLIP-seq
MIRT904598	hsa-miR-873	CLIP-seq
MIRT2678489	hsa-miR-1285	CLIP-seq
MIRT2678490	hsa-miR-1539	CLIP-seq
MIRT2678491	hsa-miR-2467-5p	CLIP-seq
MIRT2678492	hsa-miR-3187-5p	CLIP-seq
MIRT2678493	hsa-miR-326	CLIP-seq
MIRT2678494	hsa-miR-330-5p	CLIP-seq
MIRT2678495	hsa-miR-378g	CLIP-seq
MIRT2678496	hsa-miR-4257	CLIP-seq
MIRT2678497	hsa-miR-4486	CLIP-seq
MIRT2678498	hsa-miR-612	CLIP-seq

Gene ontology (GO) Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IDA	16027158, 22619279
GO:0001725	Component	Stress fiber	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	16027158, 17350576, 21044950, 26655834, 28514442, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IDA	23667561, 25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	22619279
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IDA	18775315
GO:0005886	Component	Plasma membrane	IDA	15800061
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007015	Process	Actin filament organization	IBA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IDA	16027158
GO:0030027	Component	Lamellipodium	IDA	22619279, 23667561
GO:0030027	Component	Lamellipodium	IEA
GO:0030036	Process	Actin cytoskeleton organization	IDA	18775315
GO:0031252	Component	Cell leading edge	IDA	16027158, 17456547
GO:0031529	Process	Ruffle organization	IDA	16027158
GO:0034315	Process	Regulation of Arp2/3 complex-mediated actin nucleation	IC	22619279
GO:0034316	Process	Negative regulation of Arp2/3 complex-mediated actin nucleation	IDA	17350576, 18775315
GO:0035767	Process	Endothelial cell chemotaxis	IDA	23667561
GO:0035767	Process	Endothelial cell chemotaxis	IMP	23667561
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IMP	22619279
GO:0042060	Process	Wound healing	IDA	23667561
GO:0042802	Function	Identical protein binding	IDA	16027158
GO:0045202	Component	Synapse	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	22619279
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	17456547
GO:0051015	Function	Actin filament binding	IEA
GO:0051015	Function	Actin filament binding	IMP	22364218
GO:0051017	Process	Actin filament bundle assembly	IDA	17456547
GO:0051129	Process	Negative regulation of cellular component organization	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071672	Process	Negative regulation of smooth muscle cell chemotaxis	IMP	22619279
GO:0071933	Function	Arp2/3 complex binding	IDA	16027158, 18775315
GO:0071933	Function	Arp2/3 complex binding	IPI	22619279
GO:0071944	Component	Cell periphery	IDA	22619279
GO:0090135	Process	Actin filament branching	IDA	18775315
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1902463	Process	Protein localization to cell leading edge	IDA	17350576
GO:2000394	Process	Positive regulation of lamellipodium morphogenesis	IDA	17350576

Other IDs

• MIM: 609849
• HGNC: 2253
• e!Ensembl: ENSG00000172725

Protein

• UniProt ID: Q9BR76
• Protein name: Coronin-1B (Coronin-2)
• Protein function: Regulates leading edge dynamics and cell motility in fibroblasts. May be involved in cytokinesis and signal transduction (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	73 → 111	WD domain, G-beta repeat	Repeat
  PF00400	WD40	122 → 161	WD domain, G-beta repeat	Repeat
  PF00400	WD40	170 → 204	WD domain, G-beta repeat	Repeat
  PF08953	DUF1899	5 → 70	Domain of unknown function (DUF1899)	Domain
  PF16300	WD40_4	345 → 387		Repeat

• Sequence:

  MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAF
  LVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSP
  LTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIY
  NVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFS
  RMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITEE
  PPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVMTVPRKSDLFQ
  DDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA
  PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQ
  LGRMENGDA

• Sequence length: 489

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	27622933	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	27622933	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	25454514		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37239355	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	30867049	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34970268	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25454514		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28625921		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20019842, 26330360	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CORO1B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CORO1B.