COPS9 (COP9 signalosome subunit 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 150678
Gene name COP9 signalosome subunit 9
Gene symbol COPS9
Synonyms (NCBI Gene)
CSNAPMYEOV2
Chromosome 2
Chromosome location 2q37.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 26456823
GO:0005515 Function Protein binding IPI 23776465, 26456823, 32296183
GO:0005634 Component Nucleus IDA 26456823
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA 23776465, 26456823
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619349 21314 ENSG00000172428
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WXC6
Protein name COP9 signalosome complex subunit 9 (CSN acidic protein) (CSNAP) (Myeloma-overexpressed gene 2 protein)
Protein function [Isoform 1]: Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15004 MYEOV2 1 → 55 Myeloma-overexpressed-like Family
Sequence 
MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ
Sequence length 57
Interactions View interactions

No strongly related genes found yet for COPS9.

No additional diseases found yet through genes similar to COPS9.