Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	11316
Gene name	Coat protein complex I subunit epsilon
Gene symbol	COPE
Synonyms (NCBI Gene)	epsilon-COP
Chromosome	19
Chromosome location	19p13.11
Summary	The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi memb

21 Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042729	hsa-miR-345-5p	CLASH	23622248
MIRT038601	hsa-miR-106b-3p	CLASH	23622248
MIRT035993	hsa-miR-1301-3p	CLASH	23622248
MIRT1967974	hsa-miR-1205	CLIP-seq
MIRT1967975	hsa-miR-149	CLIP-seq
MIRT1967976	hsa-miR-1909	CLIP-seq
MIRT1967977	hsa-miR-3145-3p	CLIP-seq
MIRT1967978	hsa-miR-3150a-3p	CLIP-seq
MIRT1967979	hsa-miR-3175	CLIP-seq
MIRT1967980	hsa-miR-3176	CLIP-seq
MIRT1967981	hsa-miR-3922-3p	CLIP-seq
MIRT1967982	hsa-miR-4446-3p	CLIP-seq
MIRT1967983	hsa-miR-4477a	CLIP-seq
MIRT1967984	hsa-miR-4492	CLIP-seq
MIRT1967985	hsa-miR-4498	CLIP-seq
MIRT1967986	hsa-miR-4721	CLIP-seq
MIRT1967987	hsa-miR-4728-5p	CLIP-seq
MIRT1967988	hsa-miR-4757-5p	CLIP-seq
MIRT1967989	hsa-miR-491-5p	CLIP-seq
MIRT1967990	hsa-miR-762	CLIP-seq
MIRT1967991	hsa-miR-939	CLIP-seq

24 Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	16169070, 25416956, 32296183, 33961781, 35271311
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IBA
GO:0006890	Process	Retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IEA
GO:0006891	Process	Intra-Golgi vesicle-mediated transport	IBA
GO:0006891	Process	Intra-Golgi vesicle-mediated transport	ISS
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030126	Component	COPI vesicle coat	IBA
GO:0030126	Component	COPI vesicle coat	ISS
GO:0030133	Component	Transport vesicle	TAS
GO:0030137	Component	COPI-coated vesicle	IEA
GO:0030663	Component	COPI-coated vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0099612	Process	Protein localization to axon	IEA

MIM	HGNC	e!Ensembl
606942	2234	ENSG00000105669

O14579

Protein name

Coatomer subunit epsilon (Epsilon-coat protein) (Epsilon-COP)

Protein function

The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi ne

PDB

6TZT , 6U3V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04733	Coatomer_E	15 → 305		Family

Sequence

MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAY
LAQRKFGVVLDEIKPSSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSVDVTNTTFL
LMAASIYLHDQNPDAALRALHQGDSLECTAMTVQILLKLDRLDLARKELKRMQDLDEDAT
LTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQ
EALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRL
VLQYAPSA

Sequence length

308

Interactions

View interactions

Reactome Pathway
COPI-mediated anterograde transport
COPI-dependent Golgi-to-ER retrograde traffic

COPE (coat protein complex I subunit epsilon)

Bookmark This Gene