Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	285888
Gene name	Canopy FGF signaling regulator 1
Gene symbol	CNPY1
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7q36.3
Summary	Cnpy1 is expressed in the midbrain-hindbrain (MHB) boundary in zebrafish, binds FGFR1 (MIM 136350), and plays a role in FGF signaling (Hirate and Okamoto, 2006 [PubMed 16488878]).[supplied by OMIM, Dec 2008]

37 Show/Hide all (37)

miRTarBase ID	miRNA	Experiments
MIRT901271	hsa-miR-219-2-3p	CLIP-seq
MIRT901272	hsa-miR-28-5p	CLIP-seq
MIRT901273	hsa-miR-3074-5p	CLIP-seq
MIRT901274	hsa-miR-3139	CLIP-seq
MIRT901275	hsa-miR-3168	CLIP-seq
MIRT901276	hsa-miR-3668	CLIP-seq
MIRT901277	hsa-miR-370	CLIP-seq
MIRT901278	hsa-miR-3924	CLIP-seq
MIRT901279	hsa-miR-4277	CLIP-seq
MIRT901280	hsa-miR-4433	CLIP-seq
MIRT901281	hsa-miR-4459	CLIP-seq
MIRT901282	hsa-miR-4709-3p	CLIP-seq
MIRT901283	hsa-miR-4768-3p	CLIP-seq
MIRT901284	hsa-miR-4795-3p	CLIP-seq
MIRT901285	hsa-miR-587	CLIP-seq
MIRT901286	hsa-miR-639	CLIP-seq
MIRT901287	hsa-miR-708	CLIP-seq
MIRT901288	hsa-miR-944	CLIP-seq
MIRT901271	hsa-miR-219-2-3p	CLIP-seq
MIRT901273	hsa-miR-3074-5p	CLIP-seq
MIRT901277	hsa-miR-370	CLIP-seq
MIRT901280	hsa-miR-4433	CLIP-seq
MIRT901281	hsa-miR-4459	CLIP-seq
MIRT901282	hsa-miR-4709-3p	CLIP-seq
MIRT901283	hsa-miR-4768-3p	CLIP-seq
MIRT2386294	hsa-miR-4327	CLIP-seq
MIRT2447344	hsa-miR-2276	CLIP-seq
MIRT2447345	hsa-miR-4698	CLIP-seq
MIRT2447346	hsa-miR-4772-3p	CLIP-seq
MIRT2447347	hsa-miR-518a-5p	CLIP-seq
MIRT2447348	hsa-miR-527	CLIP-seq
MIRT2505941	hsa-miR-1229	CLIP-seq
MIRT2505942	hsa-miR-1912	CLIP-seq
MIRT2505943	hsa-miR-4493	CLIP-seq
MIRT2505941	hsa-miR-1229	CLIP-seq
MIRT2505942	hsa-miR-1912	CLIP-seq
MIRT2505943	hsa-miR-4493	CLIP-seq

MIM	HGNC	e!Ensembl
612493	27786	ENSG00000146910

Q3B7I2

Protein name

Protein canopy homolog 1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11938	DUF3456	1 → 83	TLR4 regulator and MIR-interacting MSAP	Family

Sequence

MNDYKLEEDPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEI
SSLIAQETHYLADKLCSEKSDLCETSANHTEL

Sequence length

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	29228715	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	23793025	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Obesity	Obesity	Pubtator	28207535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with CNPY1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CNPY1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CNPY1 (see Related Genes above), that are NOT already directly curated for CNPY1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CNPY1.

CNPY1 (canopy FGF signaling regulator 1)

Bookmark This Gene