CMTM1 (CKLF like MARVEL transmembrane domain containing 1) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	113540
Gene name	CKLF like MARVEL transmembrane domain containing 1
Gene symbol	CMTM1
Synonyms (NCBI Gene)	CKLFHCKLFH1CKLFSF1
Chromosome	16
Chromosome location	16q21
Summary	This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular develo

1

miRTarBase ID	miRNA	Experiments	Reference
MIRT017430	hsa-miR-335-5p	Microarray	18185580

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
607884	19172	ENSG00000089505

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8IZ96
Protein name	CKLF-like MARVEL transmembrane domain-containing protein 1 (Chemokine-like factor superfamily member 1)
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Highly expressed in testis. {ECO:0000269\|PubMed:12782130, ECO:0000269\|PubMed:15147728}.
Sequence	MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFF ILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGSLCLTAV IVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA
Sequence length	169
Interactions	View interactions