CMC4 (C-X9-C motif containing 4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 100272147
• Gene name: C-X9-C motif containing 4
• Gene symbol: CMC4
• Synonyms (NCBI Gene): C6.1B, MTCP1, MTCP1B, MTCP1NB, p8, p8MTCP1
• Chromosome: X
• Chromosome location: Xq28
• Summary: This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5` exon spliced to two different sets of 3` exons that encode two dif

miRNA Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029060	hsa-miR-26b-5p	Microarray	19088304
MIRT720190	hsa-miR-3139	HITS-CLIP	19536157
MIRT720189	hsa-miR-28-5p	HITS-CLIP	19536157
MIRT720188	hsa-miR-708-5p	HITS-CLIP	19536157
MIRT720187	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT720186	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT720185	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT720184	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT720183	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT720182	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT109273	hsa-miR-558	HITS-CLIP	19536157
MIRT720181	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT720180	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT720179	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT720190	hsa-miR-3139	HITS-CLIP	19536157
MIRT720189	hsa-miR-28-5p	HITS-CLIP	19536157
MIRT720188	hsa-miR-708-5p	HITS-CLIP	19536157
MIRT720187	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT720186	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT720185	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT720184	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT720183	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT720182	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT109273	hsa-miR-558	HITS-CLIP	19536157
MIRT720181	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT720180	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT720179	hsa-miR-6833-3p	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	7784073
GO:0005739	Component	Mitochondrion	IEA
GO:0005758	Component	Mitochondrial intermembrane space	IBA

Other IDs

• MIM: 301088
• HGNC: 35428
• e!Ensembl: ENSG00000182712

Protein

• UniProt ID: P56277
• Protein name: Cx9C motif-containing protein 4 (Mature T-cell proliferation 1 neighbor protein) (Mature T-cell proliferation-1 type A) (MTCP-1 type A) (Protein p8 MTCP-1) (p8MTCP1)
• PDB: 1EI0 , 1HP8 , 2HP8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08991	MTCP1	6 → 62	Mature-T-Cell Proliferation I type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in many tissues with a relatively high level in skeletal muscle.
• Sequence:

  MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEEN
  LTRKSASK

• Sequence length: 68

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (11)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11752899	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	8570215, 8634440		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10685338		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39696784	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	7970717, 8634440, 9657733		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	30233082		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	21596366		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	26521017	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	35038703	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	8570215, 9614908		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	10786666, 11054065, 18073348, 24446122, 26917488, 31677197, 8570215, 8634440, 9315101, 9657733		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CMC4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CMC4.