CMAHP (cytidine monophospho-N-acetylneuraminic acid hydroxylase, pseudogene)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 8418
Gene name Cytidine monophospho-N-acetylneuraminic acid hydroxylase, pseudogene
Gene symbol CMAHP
Synonyms (NCBI Gene)
CMAHCSAH
Chromosome 6
Chromosome location 6p22.3
Summary Sialic acids are terminal components of the carbohydrate chains of glycoconjugates involved in ligand-receptor, cell-cell, and cell-pathogen interactions. The two most common forms of sialic acid found in mammalian cells are N-acetylneuraminic acid (Neu5A
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IDA 19890979
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 19890979
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IDA 19890979
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
603209 2098 ENSG00000293489
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y471
Protein name Inactive cytidine monophosphate-N-acetylneuraminic acid hydroxylase (CMP-NeuAc hydroxylase-like protein) (Cytidine monophosphate-N-acetylneuraminic acid hydroxylase pseudogene)
Protein function Sialic acids are components of carbohydrate chains of glycoconjugates and are involved in cell-cell recognition and cell-pathogen interactions. That protein has no CMP-N-acetylneuraminate monooxygenase activity and is not able to convert CMP-N-a
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13483 Lactamase_B_3 34 → 177 Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in thymus. Not expressed in brain. May be expressed in adult stem cells (at protein level) (PubMed:19890979). {ECO:0000269|PubMed:19890979, ECO:0000269|PubMed:9624188}.
Sequence 
MDENNGLLLLELNPPNPWDLQPRSPEELAFGEVQITYLTHACMDLKLGDKRMVFDPWLIG
PAFARGWWLLHEPPSDWLERLCQADLIYISHLHSDHLSYPTLKKLAGRRPDIPIYVGNTE
RPVFWNLNQSGVQLTNINVVPFGIWQQVDKNLRFMILMDGVHPEMDTCIIVEYKGHKILN
IVDCTRPNGGRLPMKVALMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKTERKKLLNYKA
RLVKNLQPRIYCPFAGYFVESHPSDKYIKETNTKNDPNELNNLIKKNSDVITWTPRPGAT
LDLGRMLKDRTDSKGIIEPPEGTKIYKDSWDFEPYLEILNAALGDEIFLHSSWIKEYFTW
AGFKDYNLVVRMIETDEDFNPFPGGYDYLVDFLDLSFPKERPQREHPYEEIHSRVDVIRH
VVKNGLLWDELYIGFQTRLQRDPDIYHHLFWNHFQIKLPLTPPNWKSFLMCCEQNGPVIL
QFSTERTNEPNRNKFSVENKA
Sequence length 501
Interactions View interactions

No strongly related genes found yet for CMAHP.

No additional diseases found yet through genes similar to CMAHP.