CLPSL2 (colipase like 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 389383
Gene name Colipase like 2
Gene symbol CLPSL2
Synonyms (NCBI Gene)
AAAL3045C6orf126UNQ3045dJ510O8.5
Chromosome 6
Chromosome location 6p21.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region IEA
GO:0007586 Process Digestion IEA
GO:0008047 Function Enzyme activator activity IEA
GO:0016042 Process Lipid catabolic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UWE3
Protein name Colipase-like protein 2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15083 Colipase-like 19 → 100 Colipase-like Family
Sequence 
MAAALALVAGVLSGAVLPLWSALPQYKKKITDRCFHHSECYSGCCLMDLDSGGAFCAPRA
RITMICLPQTKGATNIICPCRMGLTCISKDLMCSRRCHMI
Sequence length 100
Interactions View interactions

No strongly related genes found yet for CLPSL2.

No additional diseases found yet through genes similar to CLPSL2.