CLPSL1 (colipase like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 340204
Gene name Colipase like 1
Gene symbol CLPSL1
Synonyms (NCBI Gene)
C6orf127ESP32dJ510O8.6
Chromosome 6
Chromosome location 6p21.31
miRNA miRNA information provided by mirtarbase database.
24 Show/Hide all (24)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT455583 hsa-miR-2278 PAR-CLIP 23592263
MIRT455582 hsa-miR-4695-5p PAR-CLIP 23592263
MIRT455581 hsa-miR-1827 PAR-CLIP 23592263
MIRT455580 hsa-miR-3665 PAR-CLIP 23592263
MIRT455579 hsa-miR-766-5p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0007586 Process Digestion IEA
GO:0008047 Function Enzyme activator activity IEA
GO:0016042 Process Lipid catabolic process IEA
GO:0032094 Process Response to food IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A2RUU4
Protein name Colipase-like protein 1
Family and domains
Tissue specificity TISSUE SPECIFICITY: Exclusively expressed in epididymis, in the corpus region. {ECO:0000269|PubMed:18390568}.
Sequence 
MMLPQWLLLLFLLFFFLFLLTRGSLSPTKYNLLELKESCIRNQDCETGCCQRAPDNCESH
CAEKGSEGSLCQTQVFFGQYRACPCLRNLTCIYSKNEKWLSIAYGRCQKIGRQKLAKKMF
F
Sequence length 121
Interactions View interactions

No strongly related genes found yet for CLPSL1.

No additional diseases found yet through genes similar to CLPSL1.