CLK3 (CDC like kinase 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1198
• Gene name: CDC like kinase 3
• Gene symbol: CLK3
• Synonyms (NCBI Gene): PHCLK3, PHCLK3/152
• Chromosome: 15
• Chromosome location: 15q24.1
• Summary: This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two trans

miRNA Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025715	hsa-miR-7-5p	Sequencing	20371350
MIRT737435	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC)	31807004
MIRT896705	hsa-miR-3121-3p	CLIP-seq
MIRT896706	hsa-miR-4453	CLIP-seq
MIRT896707	hsa-miR-4538	CLIP-seq
MIRT896708	hsa-miR-4795-3p	CLIP-seq
MIRT896709	hsa-miR-4803	CLIP-seq
MIRT1965861	hsa-miR-1208	CLIP-seq
MIRT1965862	hsa-miR-205	CLIP-seq
MIRT1965863	hsa-miR-23a	CLIP-seq
MIRT1965864	hsa-miR-23b	CLIP-seq
MIRT1965865	hsa-miR-23c	CLIP-seq
MIRT1965866	hsa-miR-25	CLIP-seq
MIRT1965867	hsa-miR-32	CLIP-seq
MIRT1965868	hsa-miR-363	CLIP-seq
MIRT1965869	hsa-miR-3667-3p	CLIP-seq
MIRT1965870	hsa-miR-367	CLIP-seq
MIRT1965871	hsa-miR-4297	CLIP-seq
MIRT1965872	hsa-miR-4325	CLIP-seq
MIRT1965873	hsa-miR-4722-3p	CLIP-seq
MIRT1965874	hsa-miR-92a	CLIP-seq
MIRT1965875	hsa-miR-92b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Repression	16281084

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001669	Component	Acrosomal vesicle	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	7990150
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 21044950, 21516116, 22939624, 23455924, 23602568, 25416956, 31515488, 32296183, 32707033, 33961781, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9637771
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0006468	Process	Protein phosphorylation	IDA	9637771
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0043484	Process	Regulation of RNA splicing	IBA
GO:0043484	Process	Regulation of RNA splicing	IDA	9637771
GO:0043484	Process	Regulation of RNA splicing	IEA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 602990
• HGNC: 2071
• e!Ensembl: ENSG00000179335

Protein

• UniProt ID: P49761
• Protein name: Dual specificity protein kinase CLK3 (EC 2.7.12.1) (CDC-like kinase 3)
• Protein function: Dual specificity kinase acting on both serine/threonine and tyrosine-containing substrates. Phosphorylates serine- and arginine-rich (SR) proteins of the spliceosomal complex. May be a constituent of a network of regulatory mechanisms that enabl
• PDB: 2EU9 , 2EXE , 2WU6 , 2WU7 , 3RAW , 6FT7 , 6FYP , 6FYR , 6KHF , 6RCT , 6YTW , 6YTY , 6YU1 , 6Z2V , 6Z51 , 6Z52 , 6Z53 , 6Z54 , 6Z55 , 9EZ3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	304 → 620	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Endothelial cells. {ECO:0000269|PubMed:19168442}.
• Sequence:

  MPVLSARRRELADHAGSGRRSGPSPTARSGPHLSALRAQPARAAHLSGRGTYVRRDTAGG
  GPGQARPLGPPGTSLLGRGARRSGEGWCPGAFESGARAARPPSRVEPRLATAASREGAGL
  PRAEVAAGSGRGARSGEWGLAAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEG
  RLRYPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHR
  RRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSVEDDKEGHLVCRIGDWL
  QERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKD
  KENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALR
  FLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHT
  TIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGP
  IPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRM
  LEFDPAQRITLAEALLHPFFAGLTPEERSFHTSRNPSR

• Sequence length: 638

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
URINARY BLADDER CARCINOMA	—	GWAS catalog	25281661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	29606096	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	GWASCAT_DG	25281661		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	32453420	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	40273911	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30271587	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25281661	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CLK3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CLK3.