CLIC6 (chloride intracellular channel 6)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 54102
• Gene name: Chloride intracellular channel 6
• Gene symbol: CLIC6
• Synonyms (NCBI Gene): CLIC1L
• Chromosome: 21
• Chromosome location: 21q22.12
• Summary: This gene encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21. Alternative splicing results in multiple transcript variants encoding different isoforms

miRNA Show/Hide all (80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT646342	hsa-miR-383-5p	HITS-CLIP	23824327
MIRT646341	hsa-miR-1288-5p	HITS-CLIP	23824327
MIRT646340	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT646339	hsa-miR-5702	HITS-CLIP	23824327
MIRT646338	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT646337	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT646336	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT646335	hsa-miR-8081	HITS-CLIP	23824327
MIRT646334	hsa-miR-8055	HITS-CLIP	23824327
MIRT608889	hsa-miR-6758-5p	HITS-CLIP	24906430
MIRT608888	hsa-miR-6856-5p	HITS-CLIP	24906430
MIRT608887	hsa-miR-3976	HITS-CLIP	24906430
MIRT608886	hsa-miR-3689a-5p	HITS-CLIP	24906430
MIRT608885	hsa-miR-3689b-5p	HITS-CLIP	24906430
MIRT608884	hsa-miR-3689e	HITS-CLIP	24906430
MIRT608883	hsa-miR-3689f	HITS-CLIP	24906430
MIRT608882	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT608881	hsa-miR-6818-5p	HITS-CLIP	24906430
MIRT608880	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT608886	hsa-miR-3689a-5p	HITS-CLIP	27418678
MIRT608885	hsa-miR-3689b-5p	HITS-CLIP	27418678
MIRT608884	hsa-miR-3689e	HITS-CLIP	27418678
MIRT608883	hsa-miR-3689f	HITS-CLIP	27418678
MIRT608887	hsa-miR-3976	HITS-CLIP	27418678
MIRT608880	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT608889	hsa-miR-6758-5p	HITS-CLIP	27418678
MIRT608881	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT608888	hsa-miR-6856-5p	HITS-CLIP	27418678
MIRT608882	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT646342	hsa-miR-383-5p	HITS-CLIP	23824327
MIRT646341	hsa-miR-1288-5p	HITS-CLIP	23824327
MIRT646340	hsa-miR-4691-3p	HITS-CLIP	23824327
MIRT646339	hsa-miR-5702	HITS-CLIP	23824327
MIRT646338	hsa-miR-3157-5p	HITS-CLIP	23824327
MIRT646337	hsa-miR-937-5p	HITS-CLIP	23824327
MIRT646336	hsa-miR-627-5p	HITS-CLIP	23824327
MIRT646335	hsa-miR-8081	HITS-CLIP	23824327
MIRT646334	hsa-miR-8055	HITS-CLIP	23824327
MIRT1965781	hsa-miR-147	CLIP-seq
MIRT1965782	hsa-miR-3612	CLIP-seq
MIRT1965783	hsa-miR-3689b	CLIP-seq
MIRT1965784	hsa-miR-4443	CLIP-seq
MIRT1965785	hsa-miR-650	CLIP-seq
MIRT2201723	hsa-miR-124	CLIP-seq
MIRT1965781	hsa-miR-147	CLIP-seq
MIRT2201724	hsa-miR-320e	CLIP-seq
MIRT1965783	hsa-miR-3689b	CLIP-seq
MIRT2201725	hsa-miR-4699-5p	CLIP-seq
MIRT2201726	hsa-miR-4724-5p	CLIP-seq
MIRT2201727	hsa-miR-506	CLIP-seq
MIRT2504641	hsa-miR-103a	CLIP-seq
MIRT2504642	hsa-miR-107	CLIP-seq
MIRT2504643	hsa-miR-1184	CLIP-seq
MIRT2504644	hsa-miR-4274	CLIP-seq
MIRT2504645	hsa-miR-4418	CLIP-seq
MIRT2504646	hsa-miR-4731-5p	CLIP-seq
MIRT2504647	hsa-miR-509-3-5p	CLIP-seq
MIRT2504648	hsa-miR-509-5p	CLIP-seq
MIRT2504649	hsa-miR-548a-3p	CLIP-seq
MIRT2504650	hsa-miR-548e	CLIP-seq
MIRT2504651	hsa-miR-548f	CLIP-seq
MIRT2504641	hsa-miR-103a	CLIP-seq
MIRT2504642	hsa-miR-107	CLIP-seq
MIRT2504643	hsa-miR-1184	CLIP-seq
MIRT2678286	hsa-miR-1915	CLIP-seq
MIRT2504644	hsa-miR-4274	CLIP-seq
MIRT2678287	hsa-miR-4305	CLIP-seq
MIRT2504645	hsa-miR-4418	CLIP-seq
MIRT2678288	hsa-miR-4717-5p	CLIP-seq
MIRT2678289	hsa-miR-4726-3p	CLIP-seq
MIRT2504646	hsa-miR-4731-5p	CLIP-seq
MIRT2504647	hsa-miR-509-3-5p	CLIP-seq
MIRT2504648	hsa-miR-509-5p	CLIP-seq
MIRT2678290	hsa-miR-5096	CLIP-seq
MIRT2678291	hsa-miR-515-5p	CLIP-seq
MIRT2504649	hsa-miR-548a-3p	CLIP-seq
MIRT2504650	hsa-miR-548e	CLIP-seq
MIRT2504651	hsa-miR-548f	CLIP-seq
MIRT2678292	hsa-miR-548u	CLIP-seq
MIRT2678293	hsa-miR-583	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IDA	37838179
GO:0005254	Function	Chloride channel activity	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0031749	Function	D2 dopamine receptor binding	IBA
GO:0031750	Function	D3 dopamine receptor binding	IBA
GO:0031751	Function	D4 dopamine receptor binding	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1902476	Process	Chloride transmembrane transport	IEA

Other IDs

• MIM: 615321
• HGNC: 2065
• e!Ensembl: ENSG00000159212

Protein

• UniProt ID: Q96NY7
• Protein name: Chloride intracellular channel protein 6 (Glutaredoxin-like oxidoreductase CLIC6) (EC 1.8.-.-) (Parchorin)
• Protein function: In the soluble state, catalyzes glutaredoxin-like thiol disulfide exchange reactions with reduced glutathione as electron donor (By similarity). Can insert into membranes and form voltage-dependent chloride-selective channels. The channel opens
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13410	GST_C_2	585 → 675		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain, placenta, pancreas, liver, lung, heart, kidney, liver, spleen, soleus muscle, and brown fat. {ECO:0000269|PubMed:12226712, ECO:0000269|PubMed:37838179}.
• Sequence:

  MAEAAEPEGVAPGPQGPPEVPAPLAERPGEPGAAGGEAEGPEGSEGAEEAPRGAAAVKEA
  GGGGPDRGPEAEARGTRGAHGETEAEEGAPEGAEVPQGGEETSGAQQVEGASPGRGAQGE
  PRGEAQREPEDSAAPERQEEAEQRPEVPEGSASGEAGDSVDAEGPLGDNIEAEGPAGDSV
  EAEGRVGDSVDAEGPAGDSVDAEGPLGDNIQAEGPAGDSVDAEGRVGDSVDAEGPAGDSV
  DAEGRVGDSVEAGDPAGDGVEAGVPAGDSVEAEGPAGDSMDAEGPAGRARRVSGEPQQSG
  DGSLSPQAEAIEVAAGESAGRSPGELAWDAAEEAEVPGVKGSEEAAPGDARADAGEDRVG
  DGPQQEPGEDEERRERSPEGPREEEAAGGEEESPDSSPHGEASRGAAEPEAQLSNHLAEE
  GPAEGSGEAARVNGRREDGEASEPRALGQEHDITLFVKVKLTALGCSRIAIKKYLRAGYD
  GESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDV
  NKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIHEKNLLKAL
  RKLDNYLNSPLPDEIDAYSTEDVTVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKYRDF
  EFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVAKRMK

• Sequence length: 704

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (6)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Myoepithelial tumor	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	38723632	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	25903422	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
sellar metastasis from primary bronchial carcinoid tumor	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	34697589	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31757997, 39512680	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39966932	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34766585	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	34697589	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36915125	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34840985	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CLIC6.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CLIC6.