CLIC3 (chloride intracellular channel 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9022
• Gene name: Chloride intracellular channel 3
• Gene symbol: CLIC3
• Synonyms (NCBI Gene): -
• Chromosome: 9
• Chromosome location: 9q34.3
• Summary: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracel

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017007	hsa-miR-335-5p	Microarray	18185580
MIRT022269	hsa-miR-124-3p	Microarray	18668037

Gene ontology (GO) Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005254	Function	Chloride channel activity	IBA
GO:0005254	Function	Chloride channel activity	IEA
GO:0005254	Function	Chloride channel activity	IMP	9880541
GO:0005515	Function	Protein binding	IPI	9880541, 21044950, 25416956, 31515488, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	9880541
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9880541
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IBA
GO:0006821	Process	Chloride transport	IEA
GO:0006821	Process	Chloride transport	IMP	9880541
GO:0007165	Process	Signal transduction	TAS	9880541
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0019153	Function	Protein-disulfide reductase (glutathione) activity	IDA	28198360
GO:0031012	Component	Extracellular matrix	IDA	28198360
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IDA	28198360

Other IDs

• MIM: 606533
• HGNC: 2064
• e!Ensembl: ENSG00000169583

Protein

• UniProt ID: O95833
• Protein name: Chloride intracellular channel protein 3 (Glutaredoxin-like oxidoreductase CLIC3) (EC 1.8.-.-)
• Protein function: In the soluble state, catalyzes glutaredoxin-like thiol disulfide exchange reactions with reduced glutathione as electron donor (PubMed:28198360, PubMed:37759794). Reduced in a glutathione-dependent way and secreted into the extracellular matrix
• PDB: 3FY7 , 3KJY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13410	GST_C_2	114 → 208		Domain
  PF13417	GST_N_3	18 → 90	Glutathione S-transferase, N-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in placenta (at protein level). Widely expressed. High expression is found in placenta followed by lung and heart. Low expression in skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:17027078, ECO:0000269|PubMed:988054
• Sequence:

  MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGS
  QLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPV
  PAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKL
  HIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR

• Sequence length: 236

Related Genes

No strongly related genes found yet for CLIC3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CLIC3.