CLEC9A (C-type lectin domain containing 9A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283420
Gene name C-type lectin domain containing 9A
Gene symbol CLEC9A
Synonyms (NCBI Gene)
CD370DNGR-1DNGR1UNQ9341
Chromosome 12
Chromosome location 12p13.2
Summary CLEC9A is a group V C-type lectin-like receptor (CTLR) that functions as an activation receptor and is expressed on myeloid lineage cells (Huysamen et al., 2008 [PubMed 18408006]).[supplied by OMIM, Aug 2008]
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1965713 hsa-miR-3622b-5p CLIP-seq
MIRT2201621 hsa-miR-1915 CLIP-seq
MIRT2201622 hsa-miR-4639-5p CLIP-seq
MIRT2201623 hsa-miR-4726-3p CLIP-seq
MIRT2201624 hsa-miR-4735-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001819 Process Positive regulation of cytokine production IDA 18408006
GO:0006897 Process Endocytosis IEA
GO:0006898 Process Receptor-mediated endocytosis IBA
GO:0006898 Process Receptor-mediated endocytosis IDA 18408006, 18497879
GO:0006898 Process Receptor-mediated endocytosis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612252 26705 ENSG00000197992
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UXN8
Protein name C-type lectin domain family 9 member A (CD antigen CD370)
Protein function Functions as an endocytic receptor on a small subset of myeloid cells specialized for the uptake and processing of material from dead cells. Recognizes filamentous form of actin in association with particular actin-binding domains of cytoskeleta
PDB 3VPP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 131 → 234 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: In peripheral blood highly restricted on the surface of BDCA31(+) dendritic cells and on a small subset of CD14(+) and CD16(-) monocytes. {ECO:0000269|PubMed:18408006, ECO:0000269|PubMed:18497879}.
Sequence 
MHEEEIYTSLQWDSPAPDTYQKCLSSNKCSGACCLVMVISCVFCMGLLTASIFLGVKLLQ
VSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLSSAHNSSPCPNNWIQN
RESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQD
GHSGRWLWQDGSSPSPGLLPAERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSS
V
Sequence length 241
Interactions View interactions

No strongly related genes found yet for CLEC9A.

No additional diseases found yet through genes similar to CLEC9A.