CLEC5A (C-type lectin domain containing 5A)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 23601
• Gene name: C-type lectin domain containing 5A
• Gene symbol: CLEC5A
• Synonyms (NCBI Gene): CLECSF5, MDL-1, MDL1
• Chromosome: 7
• Chromosome location: 7q34
• Summary: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles

miRNA Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT036848	hsa-miR-877-3p	CLASH	23622248
MIRT438500	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR	24216483
MIRT438500	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR	24216483
MIRT438500	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR	24216483
MIRT438500	hsa-miR-125a-5p	Luciferase reporter assay, qRT-PCR	24216483
MIRT896148	hsa-miR-1266	CLIP-seq
MIRT896149	hsa-miR-148a	CLIP-seq
MIRT896150	hsa-miR-148b	CLIP-seq
MIRT896151	hsa-miR-152	CLIP-seq
MIRT896152	hsa-miR-3074-5p	CLIP-seq
MIRT896153	hsa-miR-3155	CLIP-seq
MIRT896154	hsa-miR-3155b	CLIP-seq
MIRT896155	hsa-miR-3160-5p	CLIP-seq
MIRT896156	hsa-miR-339-5p	CLIP-seq
MIRT896157	hsa-miR-3664-3p	CLIP-seq
MIRT896158	hsa-miR-3692	CLIP-seq
MIRT896159	hsa-miR-3925-3p	CLIP-seq
MIRT896160	hsa-miR-4421	CLIP-seq
MIRT896161	hsa-miR-4518	CLIP-seq
MIRT896162	hsa-miR-4680-5p	CLIP-seq
MIRT896163	hsa-miR-484	CLIP-seq
MIRT896164	hsa-miR-515-5p	CLIP-seq
MIRT896165	hsa-miR-766	CLIP-seq
MIRT1965684	hsa-miR-1236	CLIP-seq
MIRT1965685	hsa-miR-3127-5p	CLIP-seq
MIRT1965686	hsa-miR-3158-3p	CLIP-seq
MIRT1965687	hsa-miR-3918	CLIP-seq
MIRT1965688	hsa-miR-513a-3p	CLIP-seq
MIRT1965689	hsa-miR-593	CLIP-seq
MIRT1965690	hsa-miR-595	CLIP-seq
MIRT1965691	hsa-miR-628-5p	CLIP-seq
MIRT2201610	hsa-miR-125a-3p	CLIP-seq
MIRT896148	hsa-miR-1266	CLIP-seq
MIRT2201611	hsa-miR-2113	CLIP-seq
MIRT2201612	hsa-miR-218	CLIP-seq
MIRT896152	hsa-miR-3074-5p	CLIP-seq
MIRT896157	hsa-miR-3664-3p	CLIP-seq
MIRT2201613	hsa-miR-3934	CLIP-seq
MIRT896160	hsa-miR-4421	CLIP-seq
MIRT896161	hsa-miR-4518	CLIP-seq
MIRT2201614	hsa-miR-636	CLIP-seq
MIRT2201615	hsa-miR-764	CLIP-seq
MIRT2504476	hsa-miR-1193	CLIP-seq
MIRT2504477	hsa-miR-296-3p	CLIP-seq
MIRT2504478	hsa-miR-4521	CLIP-seq
MIRT2504479	hsa-miR-627	CLIP-seq
MIRT2504480	hsa-miR-924	CLIP-seq
MIRT2504476	hsa-miR-1193	CLIP-seq
MIRT2504477	hsa-miR-296-3p	CLIP-seq
MIRT2504478	hsa-miR-4521	CLIP-seq
MIRT2504479	hsa-miR-627	CLIP-seq
MIRT2504480	hsa-miR-924	CLIP-seq

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IBA
GO:0001618	Function	Virus receptor activity	IDA	18496526
GO:0001618	Function	Virus receptor activity	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002076	Process	Osteoblast development	IEA
GO:0002076	Process	Osteoblast development	ISS
GO:0002376	Process	Immune system process	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10449773
GO:0006968	Process	Cellular defense response	TAS	10449773
GO:0007165	Process	Signal transduction	TAS	10449773
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0016020	Component	Membrane	IEA
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	18496526
GO:0045087	Process	Innate immune response	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0070821	Component	Tertiary granule membrane	TAS

Other IDs

• MIM: 604987
• HGNC: 2054
• e!Ensembl: ENSG00000258227

Protein

• UniProt ID: Q9NY25
• Protein name: C-type lectin domain family 5 member A (C-type lectin superfamily member 5) (Myeloid DAP12-associating lectin 1) (MDL-1)
• Protein function: Functions as a positive regulator of osteoclastogenesis (By similarity). Cell surface receptor that signals via TYROBP (PubMed:10449773). Regulates inflammatory responses (By similarity). {ECO:0000250|UniProtKB:Q9R007, ECO:0000269|PubMed:1044977
• PDB: 2YHF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	88 → 185	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in bone marrow with lower levels in synovium, lung and bronchus (PubMed:20212065). Expressed in peripheral blood monocytes and in the monocyte/macrophage cell lines U-937 and Mono-Mac-6, but not in cell lines of other
• Sequence:

  MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNG
  FITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQD
  ITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYR
  RICEKNAK

• Sequence length: 188

Pathways

Reactome Pathway

DAP12 interactions

Neutrophil degranulation

Related Genes

No strongly related genes found yet for CLEC5A.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CLEC5A.