CLEC2A (C-type lectin domain family 2 member A)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 387836
Gene name C-type lectin domain family 2 member A
Gene symbol CLEC2A
Synonyms (NCBI Gene)
INPE5792KACLPILARUNQ5792
Chromosome 12
Chromosome location 12p13.31
Summary CLEC2A belongs to the CLEC2 family of activation-induced, natural killer gene complex-encoded C-type lectin-like receptors (Spreu et al., 2007 [PubMed 18046548]).[supplied by OMIM, May 2008]
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT895808 hsa-miR-1323 CLIP-seq
MIRT895809 hsa-miR-150 CLIP-seq
MIRT895810 hsa-miR-496 CLIP-seq
MIRT895811 hsa-miR-548o CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20194751, 23803857, 32296183
GO:0005886 Component Plasma membrane IDA
GO:0005886 Component Plasma membrane IEA
GO:0009897 Component External side of plasma membrane IBA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612087 24191 ENSG00000188393
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UVW9
Protein name C-type lectin domain family 2 member A (Keratinocyte-associated C-type lectin) (KACL) (Proliferation-induced lymphocyte-associated receptor) (PILAR)
Protein function Membrane-bound protein expressed mainly on keratinocytes which acts as a ligand to stimulate the activating receptor NKp65/KLRF2, expressed on the surface of natural killer (NK) cells (PubMed:25510854). Facilitates thereby dedicated immune recog
PDB 4IOP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 75 → 159 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in skin. Also expressed in keratinocytes, spleen, thymus, small intestine, peripheral blood monocytes, bone marrow, ovary, testis and skin. High expression in CD8(+), B-lymphocytes and naive CD4(+) T-cells. Restricted
Sequence 
MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSG
DWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSR
KQGDSWKWTNGTTFNGWFEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL
Sequence length 174
Interactions View interactions

No strongly related genes found yet for CLEC2A.

No additional diseases found yet through genes similar to CLEC2A.