CLEC18C (C-type lectin domain family 18 member C)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283971
Gene name C-type lectin domain family 18 member C
Gene symbol CLEC18C
Synonyms (NCBI Gene)
MRCLMRCL3
Chromosome 16
Chromosome location 16q22.1
miRNA miRNA information provided by mirtarbase database.
8 Show/Hide all (8)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT895787 hsa-miR-1250 CLIP-seq
MIRT895788 hsa-miR-3907 CLIP-seq
MIRT895787 hsa-miR-1250 CLIP-seq
MIRT2201514 hsa-miR-1915 CLIP-seq
MIRT895788 hsa-miR-3907 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005768 Component Endosome IEA
GO:0005768 Component Endosome TAS 26170455
GO:0005783 Component Endoplasmic reticulum IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616573 28538 ENSG00000157335
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NCF0
Protein name C-type lectin domain family 18 member C (Mannose receptor-like protein 3)
Protein function Binds polysaccharidesin a Ca(2+)-independent manner with a preferentially binding to fucoidan, beta-glucans and galactans.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 316 → 434 Lectin C-type domain Domain
PF00188 CAP 52 → 182 Cysteine-rich secretory protein family Domain
Tissue specificity TISSUE SPECIFICITY: Detected in peripheral blood cells. {ECO:0000269|PubMed:26170455}.
Sequence 
MLHPETSPGRGHLLAVLLALLGTAWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRS
WVQPPAADMRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASF
VEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIEAFVC
AYSPRGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHG
RLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPFH
TCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGRLETTNEVI
DSDFETRNFWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGFGNCVELQASAAFNWN
NQRCKTRNRYICQFAQEHISRWGPGS
Sequence length 446
Interactions View interactions

No strongly related genes found yet for CLEC18C.

No additional diseases found yet through genes similar to CLEC18C.