Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1160
Gene name	Creatine kinase, mitochondrial 2
Gene symbol	CKMT2
Synonyms (NCBI Gene)	SMTCK
Chromosome	5
Chromosome location	5q14.1
Summary	Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiqui

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004111	Function	Creatine kinase activity	IBA
GO:0004111	Function	Creatine kinase activity	IEA
GO:0004111	Function	Creatine kinase activity	TAS	2324105
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	2324105
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006936	Process	Muscle contraction	TAS	2324105
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016772	Function	Transferase activity, transferring phosphorus-containing groups	IEA
GO:0046314	Process	Phosphocreatine biosynthetic process	IBA
GO:0046314	Process	Phosphocreatine biosynthetic process	IEA

MIM	HGNC	e!Ensembl
123295	1996	ENSG00000131730

P17540

Protein name

Creatine kinase S-type, mitochondrial (EC 2.7.3.2) (Basic-type mitochondrial creatine kinase) (Mib-CK) (Sarcomeric mitochondrial creatine kinase) (S-MtCK)

Protein function

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skelet

PDB

4Z9M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00217	ATP-gua_Ptrans	187 → 401	ATP:guanido phosphotransferase, C-terminal catalytic domain	Domain
PF02807	ATP-gua_PtransN	58 → 128	ATP:guanido phosphotransferase, N-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Sarcomere-specific. Found only in heart and skeletal muscles.

Sequence

MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKH
NNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA
DLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPAC
TRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAG
MARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQE
RGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVD
TAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK

Sequence length

419

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Arginine and proline metabolism	Creatine metabolism
Metabolic pathways

CKMT2 (creatine kinase, mitochondrial 2)

Bookmark This Gene