Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	85457
Gene name	CLOCK interacting pacemaker
Gene symbol	CIPC
Synonyms (NCBI Gene)	KIAA1737
Chromosome	14
Chromosome location	14q24.3

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0042754	Process	Negative regulation of circadian rhythm	IEA
GO:0042754	Process	Negative regulation of circadian rhythm	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0048511	Process	Rhythmic process	IEA

MIM	HGNC	e!Ensembl
616995	20365	ENSG00000198894

Q9C0C6

Protein name

CLOCK-interacting pacemaker (CLOCK-interacting circadian protein)

Protein function

Transcriptional repressor which may act as a negative-feedback regulator of CLOCK-BMAL1 transcriptional activity in the circadian-clock mechanism. May stimulate BMAL1-dependent phosphorylation of CLOCK. However, the physiological relevance of th

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15800	CiPC	38 → 376	Clock interacting protein circadian	Family

Sequence

MERKNPSRESPRRLSAKVGKGTEMKKVARQLGMAAAESDKDSGFSDGSSECLSSAEQMES
EDMLSALGWSREDRPRQNSKTAKNAFPTLSPMVVMKNVLVKQGSSSSQLQSWTVQPSFEV
ISAQPQLLFLHPPVPSPVSPCHTGEKKSDSRNYLPILNSYTKIAPHPGKRGLSLGPEEKG
TSGVQKKICTERLGPSLSSSEPTKAGAVPSSPSTPAPPSAKLAEDSALQGVPSLVAGGSP
QTLQPVSSSHVAKAPSLTFASPASPVCASDSTLHGLESNSPLSPLSANYSSPLWAAEHLC
RSPDIFSEQRQSKHRRFQNTLVVLHKSGLLEITLKTKELIRQNQATQVELDQLKEQTQLF
IEATKSRAPQAWAKLQASLTPGSSNTGSDLEAFSDHPAI

Sequence length

399

Interactions

View interactions

Related Genes Genes most often co-reported with CIPC across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CIPC.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CIPC (see Related Genes above), that are NOT already directly curated for CIPC itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CIPC.

CIPC (CLOCK interacting pacemaker)

Bookmark This Gene