CIMAP1D (CIMAP1 family member D)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 284451
Gene name CIMAP1 family member D
Gene symbol CIMAP1D
Synonyms (NCBI Gene)
C19orf19ODF3L2
Chromosome 19
Chromosome location 19p13.3
miRNA miRNA information provided by mirtarbase database.
14 Show/Hide all (14)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT740182 hsa-miR-2277-3p CLIP-seq
MIRT740183 hsa-miR-3660 CLIP-seq
MIRT1202340 hsa-miR-3661 CLIP-seq
MIRT1202341 hsa-miR-3690 CLIP-seq
MIRT740181 hsa-miR-3925-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005856 Component Cytoskeleton IBA
GO:0005881 Component Cytoplasmic microtubule IBA
GO:0005881 Component Cytoplasmic microtubule IDA 23264731
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q3SX64
Protein name Protein CIMAP1D (CIMAP1 family member D) (Outer dense fiber protein 3-like protein 2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07004 SHIPPO-rpt 237 → 267 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 121 → 151 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 201 → 231 Sperm-tail PG-rich repeat Repeat
Sequence 
MGTLSCDSTPRLATAPLGRRVTEGQIPETGLRKSCGTATLENGSGPGLYVLPSTVGFINH
DCTRVASPAYSLVRRPSEAPPQDTSPGPIYFLDPKVTRFGRSCTPAYSMQGRAKSRGPEV
TPGPGAYSPEKVPPVRHRTPPAFTLGCRLPLKPLDTSAPAPNAYTMPPLWGSQIFTKPSS
PSYTVVGRTPPARPPQDPAEIPGPGQYDSPDANTYRQRLPAFTMLGRPRAPRPLEETPGP
GAHCPEQVTVNKARAPAFSMGIRHSKRASTMAATTPSRPAGHRLPGRCC
Sequence length 289
Interactions View interactions

No strongly related genes found yet for CIMAP1D.

No additional diseases found yet through genes similar to CIMAP1D.