CIB4 (calcium and integrin binding family member 4)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 130106
Gene name Calcium and integrin binding family member 4
Gene symbol CIB4
Synonyms (NCBI Gene)
KIP4
Chromosome 2
Chromosome location 2p23.3
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1920358 hsa-miR-1914 CLIP-seq
MIRT1920358 hsa-miR-1914 CLIP-seq
MIRT1920358 hsa-miR-1914 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IBA
GO:0000287 Function Magnesium ion binding IDA 22779914
GO:0000287 Function Magnesium ion binding IEA
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 22779914
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610646 33703 ENSG00000157884
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0PJX0
Protein name Calcium and integrin-binding family member 4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13499 EF-hand_7 99 → 169 EF-hand domain pair Domain
Sequence 
MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPA
LRVNPFRDRICRVFSHKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEE
DLQRIILRLLNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRI
HFWGC
Sequence length 185
Interactions View interactions

No strongly related genes found yet for CIB4.

No additional diseases found yet through genes similar to CIB4.