Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51647
Gene name	Cytosolic iron-sulfur assembly component 2B
Gene symbol	CIAO2B
Synonyms (NCBI Gene)	CGI-128CIA2BFAM96BMIP18
Chromosome	16
Chromosome location	16q22.1

19 Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 20797633, 21516116, 23585563, 23891004, 24981860, 25416956, 28178521, 28514442, 30742009, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	20797633
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	20797633
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	20797633
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007059	Process	Chromosome segregation	IEA
GO:0007059	Process	Chromosome segregation	IMP	20797633
GO:0030496	Component	Midbody	IEA
GO:0051604	Process	Protein maturation	IBA
GO:0051604	Process	Protein maturation	IEA
GO:0051604	Process	Protein maturation	IMP	23891004
GO:0071817	Component	MMXD complex	IDA	20797633
GO:0097361	Component	Cytosolic [4Fe-4S] assembly targeting complex	IBA
GO:0097361	Component	Cytosolic [4Fe-4S] assembly targeting complex	IDA	22678361, 22678362, 23585563, 23891004

MIM	HGNC	e!Ensembl
614778	24261	ENSG00000166595

Q9Y3D0

Protein name

Cytosolic iron-sulfur assembly component 2B (MSS19-interacting protein of 18 kDa) (Mitotic spindle-associated MMXD complex subunit MIP18) (Protein FAM96B)

Protein function

Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins (PubMed:22678361, PubMed:22678362, PubMed:23891004, PubMed

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01883	FeS_assembly_P	43 → 121	Iron-sulfur cluster assembly protein	Domain

Sequence

MVGGGGVGGGLLENANPLIYQRSGERPVTAGEEDEQVPDSIDAREIFDLIRSINDPEHPL
TLEELNVVEQVRVQVSDPESTVAVAFTPTIPHCSMATLIGLSIKVKLLRSLPQRFKMDVH
ITPGTHASEHAVNKQLADKERVAAALENTHLLEVVNQCLSARS

Sequence length

163

Interactions

View interactions

Related Genes Genes most often co-reported with CIAO2B across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CIAO2B.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CIAO2B (see Related Genes above), that are NOT already directly curated for CIAO2B itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CIAO2B.

CIAO2B (cytosolic iron-sulfur assembly component 2B)

Save This Analysis