CHRNA10 (cholinergic receptor nicotinic alpha 10 subunit)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 57053
• Gene name: Cholinergic receptor nicotinic alpha 10 subunit
• Gene symbol: CHRNA10
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11p15.4

miRNA Show/Hide all (29)

miRTarBase ID	miRNA	Experiments	Reference
MIRT891665	hsa-miR-1266	CLIP-seq
MIRT891666	hsa-miR-28-5p	CLIP-seq
MIRT891667	hsa-miR-3136-3p	CLIP-seq
MIRT891668	hsa-miR-3139	CLIP-seq
MIRT891669	hsa-miR-3150a-3p	CLIP-seq
MIRT891670	hsa-miR-3175	CLIP-seq
MIRT891671	hsa-miR-3611	CLIP-seq
MIRT891672	hsa-miR-3614-5p	CLIP-seq
MIRT891673	hsa-miR-3664-3p	CLIP-seq
MIRT891674	hsa-miR-4266	CLIP-seq
MIRT891675	hsa-miR-4518	CLIP-seq
MIRT891676	hsa-miR-4519	CLIP-seq
MIRT891677	hsa-miR-491-5p	CLIP-seq
MIRT891678	hsa-miR-634	CLIP-seq
MIRT891679	hsa-miR-708	CLIP-seq
MIRT891680	hsa-miR-939	CLIP-seq
MIRT1964270	hsa-miR-378	CLIP-seq
MIRT1964271	hsa-miR-378b	CLIP-seq
MIRT1964272	hsa-miR-378c	CLIP-seq
MIRT1964273	hsa-miR-378d	CLIP-seq
MIRT1964274	hsa-miR-378e	CLIP-seq
MIRT1964275	hsa-miR-378f	CLIP-seq
MIRT1964276	hsa-miR-378h	CLIP-seq
MIRT1964277	hsa-miR-378i	CLIP-seq
MIRT1964278	hsa-miR-422a	CLIP-seq
MIRT1964279	hsa-miR-4638-3p	CLIP-seq
MIRT1964280	hsa-miR-617	CLIP-seq
MIRT2200382	hsa-miR-4328	CLIP-seq
MIRT2200383	hsa-miR-582-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005102	Function	Signaling receptor binding	TAS	11350119
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005262	Function	Calcium channel activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005892	Component	Acetylcholine-gated channel complex	IDA	11752216
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IGI	18420419
GO:0007210	Process	Serotonin receptor signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007271	Process	Synaptic transmission, cholinergic	IEA
GO:0007271	Process	Synaptic transmission, cholinergic	TAS	11350119
GO:0010996	Process	Response to auditory stimulus	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	11350119
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	IEA
GO:0022850	Function	Serotonin-gated monoatomic cation channel activity	IBA
GO:0030424	Component	Axon	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034703	Component	Cation channel complex	IDA	11752216
GO:0042127	Process	Regulation of cell population proliferation	TAS	11350119
GO:0042391	Process	Regulation of membrane potential	IBA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043204	Component	Perikaryon	IEA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0050910	Process	Detection of mechanical stimulus involved in sensory perception of sound	IBA
GO:0050910	Process	Detection of mechanical stimulus involved in sensory perception of sound	IEA
GO:0051899	Process	Membrane depolarization	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098878	Component	Neurotransmitter receptor complex	IDA	11752216
GO:0098981	Component	Cholinergic synapse	IEA
GO:0099634	Component	Postsynaptic specialization membrane	IEA
GO:1902495	Component	Transmembrane transporter complex	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IEA

Other IDs

• MIM: 606372
• HGNC: 13800
• e!Ensembl: ENSG00000129749

Protein

• UniProt ID: Q9GZZ6
• Protein name: Neuronal acetylcholine receptor subunit alpha-10 (Nicotinic acetylcholine receptor subunit alpha-10) (NACHR alpha-10)
• Protein function: Component of neuronal acetylcholine receptors (nAChRs) that function as pentameric, ligand-gated cation channels with high calcium permeability. nAChRs are excitatory neurotrasnmitter receptors formed by a collection of nAChR subunits. Each nAch
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02931	Neur_chan_LBD	30 → 236	Neurotransmitter-gated ion-channel ligand binding domain	Family
  PF02932	Neur_chan_memb	243 → 373	Neurotransmitter-gated ion-channel transmembrane region	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in inner-ear tissue, tonsil, immortalized B-cells, cultured T-cells and peripheral blood lymphocytes. {ECO:0000269|PubMed:11752216, ECO:0000269|PubMed:15531379}.
• Sequence:

  MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLE
  VTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYN
  KADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGH
  QLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
  CNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGK
  YYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCVRERGEPCGQS
  RPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWK
  RLARVMDRFFLAIFFSMALVMSLLVLVQAL

• Sequence length: 450

Pathways

KEGG Pathway:

Neuroactive ligand-receptor interaction

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

No strongly related genes found yet for CHRNA10.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CHRNA10.