Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	100307126
Gene name	Charged multivesicular body protein 4B pseudogene 1
Gene symbol	CHMP4BP1
Synonyms (NCBI Gene)	-
Chromosome	14
Chromosome location	14q22.3

24 Show/Hide all (24)

GO ID	Ontology	Definition	Evidence
GO:0000776	Component	Kinetochore	IEA
GO:0000815	Component	ESCRT III complex	IBA
GO:0001778	Process	Plasma membrane repair	IEA
GO:0005643	Component	Nuclear pore	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005771	Component	Multivesicular body	IBA
GO:0005828	Component	Kinetochore microtubule	IEA
GO:0006900	Process	Vesicle budding from membrane	IBA
GO:0007034	Process	Vacuolar transport	IEA
GO:0007080	Process	Mitotic metaphase chromosome alignment	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IBA
GO:0030496	Component	Midbody	IEA
GO:0031468	Process	Nuclear membrane reassembly	IEA
GO:0032511	Process	Late endosome to vacuole transport via multivesicular body sorting pathway	IBA
GO:0032585	Component	Multivesicular body membrane	IEA
GO:0039702	Process	Viral budding via host ESCRT complex	IEA
GO:0043162	Process	Ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IEA
GO:0046761	Process	Viral budding from plasma membrane	IEA
GO:0061952	Process	Midbody abscission	IEA
GO:0071985	Process	Multivesicular body sorting pathway	IEA
GO:0097352	Process	Autophagosome maturation	IEA
GO:1901673	Process	Regulation of mitotic spindle assembly	IEA
GO:1902774	Process	Late endosome to lysosome transport	IEA
GO:1904930	Component	Amphisome membrane	IEA

MIM	HGNC	e!Ensembl
HGNC	43616	N/A

P59074

Protein name

Putative charged multivesicular body protein 4B-like protein CHMP4BP1 (Charged multivesicular body protein 4B pseudogene 1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03357	Snf7	1 → 159	Snf7	Family

Sequence

MLSKKQEFLEKKIEQRHGTKNKPAALQALKRKKRYEKQLAQIDGTLSTIEFQQQALENAN
TNTEVLKNMGSAAKAKKAAHDNMDIDKVDELMQDIADQQELGEEISTAISKPVGFGEKSD
EDELMAELEELEQEEPDKNLLEVSGPETVPLPNVPSIALPSKPAKKRKTTT

Sequence length

171

Interactions

View interactions

Related Genes Genes most often co-reported with CHMP4BP1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CHMP4BP1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CHMP4BP1 (see Related Genes above), that are NOT already directly curated for CHMP4BP1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CHMP4BP1.

CHMP4BP1 (charged multivesicular body protein 4B pseudogene 1)

Bookmark This Gene