CHCHD2P9 (coiled-coil-helix-coiled-coil-helix domain containing 2 pseudogene 9)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 645345
Gene name Coiled-coil-helix-coiled-coil-helix domain containing 2 pseudogene 9
Gene symbol CHCHD2P9
Synonyms (NCBI Gene)
C9orf49CHCHD9
Chromosome 9
Chromosome location 9q21.31
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 23676 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T1J5
Protein name Putative coiled-coil-helix-coiled-coil-helix domain-containing protein CHCHD2P9, mitochondrial (Coiled-coil-helix-coiled-coil-helix domain-containing 2 pseudogene 9)
Family and domains
Sequence 
MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMA
TTAAGVAVGSAVGHTQGHAVTGGFSGGSNAEPARPDIAYQEPQGTQPAQQQQPCFYGIKQ
FLECAQNQGDIKLCEDFSKVLKQCRLAKGLA
Sequence length 151
Interactions View interactions

No strongly related genes found yet for CHCHD2P9.

No additional diseases found yet through genes similar to CHCHD2P9.