Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	94027
Gene name	Chorionic gonadotropin subunit beta 7
Gene symbol	CGB7
Synonyms (NCBI Gene)	CG-beta-aCGB6
Chromosome	19
Chromosome location	19q13.33
Summary	This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 7 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biologi

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	TAS	6690982
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0006915	Process	Apoptotic process	TAS	7723844
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10468638
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007267	Process	Cell-cell signaling	TAS	6194155
GO:0007292	Process	Female gamete generation	TAS	10468638

MIM	HGNC	e!Ensembl
608826	16451	ENSG00000196337

P0DN87

Protein name

Choriogonadotropin subunit beta 7

Protein function

Beta subunit of the human chorionic gonadotropin (hCG). hCG is a complex glycoprotein composed of two glycosylated subunits alpha and beta which are non-covalently associated. The alpha subunit is identical to those in the pituitary gonadotropin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00007	Cys_knot	26 → 130	Cystine-knot domain	Domain

Tissue specificity

TISSUE SPECIFICITY: High expression in the placenta throughout pregnancy. {ECO:0000269|PubMed:16123088}.

Sequence

MEMFQGLLLLLLLSMGGTWASREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT
MTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC
GGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ

Sequence length

165

Interactions

View interactions

Related Genes Genes most often co-reported with CGB7 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for CGB7.

Diseases Linked via Similar Genes Diseases curated for genes most similar to CGB7 (see Related Genes above), that are NOT already directly curated for CGB7 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to CGB7.

CGB7 (chorionic gonadotropin subunit beta 7)

Bookmark This Gene