CGB2 (chorionic gonadotropin subunit beta 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 114336
Gene name Chorionic gonadotropin subunit beta 2
Gene symbol CGB2
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19q13.33
Summary The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone beta (LHB) subunit gene.
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IEA
GO:0005179 Function Hormone activity IEA
GO:0005179 Function Hormone activity IMP 19523396
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
608824 16722 ENSG00000104818
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6NT52
Protein name Choriogonadotropin subunit beta variant 2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00007 Cys_knot 24 → 128 Cystine-knot domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, testis and pituitary. {ECO:0000269|PubMed:16123088, ECO:0000269|PubMed:18048458}.
Sequence 
MSKGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMT
RVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGG
PKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
Sequence length 163
Interactions View interactions

No strongly related genes found yet for CGB2.

No additional diseases found yet through genes similar to CGB2.