CFAP90 (cilia and flagella associated protein 90)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 134121
• Gene name: Cilia and flagella associated protein 90
• Gene symbol: CFAP90
• Synonyms (NCBI Gene): C5orf49
• Chromosome: 5
• Chromosome location: 5p15.31

miRNA Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT849800	hsa-miR-4261	CLIP-seq
MIRT849801	hsa-miR-561	CLIP-seq
MIRT849802	hsa-miR-935	CLIP-seq
MIRT2189884	hsa-miR-134	CLIP-seq
MIRT2189885	hsa-miR-186	CLIP-seq
MIRT2189886	hsa-miR-1914	CLIP-seq
MIRT2189887	hsa-miR-2467-5p	CLIP-seq
MIRT2189888	hsa-miR-3118	CLIP-seq
MIRT2189889	hsa-miR-3164	CLIP-seq

Gene ontology (GO) Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005929	Component	Cilium	IEA
GO:0005930	Component	Axoneme	IDA	36191189
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0036064	Component	Ciliary basal body	IDA	29257953
GO:0036126	Component	Sperm flagellum	IEA
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0160112	Component	Axonemal B tubule inner sheath	IEA
GO:0160112	Component	Axonemal B tubule inner sheath	ISS

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A4QMS7
• Protein name: Cilia- and flagella-associated protein 90
• Protein function: Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.
• PDB: 7UNG , 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15074	DUF4541	42 → 133	Domain of unknown function (DUF4541)	Family

• Sequence:

  MEDDEEETTASTLRGKPRPPPVSAQSAFSYIPPRRLDPKEHSYYYRPARTGIISLYDCIF
  KRRLDYDQKLHRDDREHAKSLGLHVNEEEQERPVGVLTSSVYGKRINQPIEPLNRDFGRA
  NHVQADFYRKNDIPSLKEPGFGHIAPS

• Sequence length: 147

Related Genes

No strongly related genes found yet for CFAP90.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CFAP90.