CFAP73 (cilia and flagella associated protein 73)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 387885
Gene name Cilia and flagella associated protein 73
Gene symbol CFAP73
Synonyms (NCBI Gene)
CCDC42BMIA2
Chromosome 12
Chromosome location 12q24.13
miRNA miRNA information provided by mirtarbase database.
9 Show/Hide all (9)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT718221 hsa-miR-4269 HITS-CLIP 19536157
MIRT718220 hsa-miR-6715b-5p HITS-CLIP 19536157
MIRT718219 hsa-miR-4645-5p HITS-CLIP 19536157
MIRT718218 hsa-miR-4673 HITS-CLIP 19536157
MIRT718217 hsa-miR-6801-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003341 Process Cilium movement ISS
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005929 Component Cilium IEA
GO:0031514 Component Motile cilium ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NFT4
Protein name Cilia- and flagella-associated protein 73 (Coiled-coil domain-containing protein 42B)
Protein function May play a role in ciliary/flagellar motility by regulating the assembly and the activity of axonemal inner dynein arm.
PDB 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13863 DUF4200 35 → 153 Domain of unknown function (DUF4200) Family
Sequence 
MAVPWEEYFRLALQEKLSTKLPEQAEDHVPPVLRLLEKRQELVDADQALQAQKEVFRTKT
AALKQRWEQLEQKERELKGSFIRFDKFLQDSEARRNRALRRAAEERHQAGRREVEALRLW
TQLQELRREHARLQRRLKRLEPCARLLEQALELLPGFQEVPELVARFDGLAETQAALRLR
EREQLAELEAARARLQQLRDAWPDEVLAQGQRRAQLQERLEAARERTLQWESKWIQIQNT
AAEKTLLLGRSRMAVLNLFQLVCQHQGQPPTLDIEDTEGQLEHVKLFMQDLSAMLAGLGQ
AEPAAPAS
Sequence length 308
Interactions View interactions

No strongly related genes found yet for CFAP73.

No additional diseases found yet through genes similar to CFAP73.