CFAP126 (cilia and flagella associated protein 126) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	257177
Gene name	Cilia and flagella associated protein 126
Gene symbol	CFAP126
Synonyms (NCBI Gene)	C1orf192FlattopFltp
Chromosome	1
Chromosome location	1q23.3

23 Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IDA	36191189
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005929	Component	Cilium	IDA
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	ISS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0030030	Process	Cell projection organization	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0031514	Component	Motile cilium	IEA
GO:0036064	Component	Ciliary basal body	IBA
GO:0036064	Component	Ciliary basal body	ISS
GO:0036126	Component	Sperm flagellum	ISS
GO:0042995	Component	Cell projection	IEA
GO:0044782	Process	Cilium organization	IBA
GO:0044782	Process	Cilium organization	ISS
GO:0160112	Component	Axonemal B tubule inner sheath	ISS

MIM	HGNC	e!Ensembl
616119	32325	ENSG00000188931

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q5VTH2
Protein name	Protein Flattop (Cilia- and flagella-associated protein 126)
Protein function	Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme (PubMed:36191189). Acts as a regulator of cilium basal body docking and positioning in mono- and multiciliated cells (By similarity). Regul
PDB	7UNG , 8J07
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed in airway epithelial cells. {ECO:0000269\|PubMed:36191189}.
Sequence	MATNYSANQYEKAFSSKYLQNWSPTKPTKESISSHEGYTQIIANDRGHLLPSVPRSKANP WGSFMGTWQMPLKIPPARVTLTSRTTAGAASLTKWIQKNPDLLKASNGLCPEILGKPHDP DSQKKLRKKSITKTVQQARSPTIIPSSPAANLNSPDELQSSHPSAGHTPGPQRPAKS
Sequence length	177
Interactions	View interactions