CEMP1 (cementum protein 1) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	752014
Gene name	Cementum protein 1
Gene symbol	CEMP1
Synonyms (NCBI Gene)	CP-23CP23
Chromosome	16
Chromosome location	16p13.3

11 Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030096	hsa-miR-26b-5p	Microarray	19088304
MIRT2446831	hsa-miR-1236	CLIP-seq
MIRT2446832	hsa-miR-3675-3p	CLIP-seq
MIRT2446833	hsa-miR-377	CLIP-seq
MIRT2446834	hsa-miR-412	CLIP-seq
MIRT2446835	hsa-miR-4652-3p	CLIP-seq
MIRT2446836	hsa-miR-4753-3p	CLIP-seq
MIRT2446837	hsa-miR-4768-5p	CLIP-seq
MIRT2446838	hsa-miR-513c	CLIP-seq
MIRT2446839	hsa-miR-514b-5p	CLIP-seq
MIRT2446840	hsa-miR-942	CLIP-seq

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	21465469
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	21465469
GO:0005737	Component	Cytoplasm	IEA
GO:0008283	Process	Cell population proliferation	IDA	17509525, 21929512
GO:0030154	Process	Cell differentiation	IEA
GO:0030154	Process	Cell differentiation	IMP	21465469
GO:0031214	Process	Biomineral tissue development	IDA	17509525, 19393626
GO:0042476	Process	Odontogenesis	IDA	21929512
GO:0046848	Function	Hydroxyapatite binding	IDA	19393626

MIM	HGNC	e!Ensembl
611113	32553	ENSG00000205923

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q6PRD7
Protein name	Cementoblastoma-derived protein 1 (Cementum protein 1) (Cementum protein 23) (CP-23)
Protein function	May play a role in development of the periodontium which surrounds and supports the teeth by promoting the differentiation of multi-potent cells from the periodontal ligament into cementoblasts to form the cementum (PubMed:17509525, PubMed:21465
PDB	7TB9
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed by cementoblasts, a subpopulation of periodontal ligament cells and cells located around vessels in periodontium (at protein level). {ECO:0000269\|PubMed:16263347, ECO:0000269\|PubMed:21465469}.
Sequence	MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAV KAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCS LPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGE KVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTED GRMTLMG
Sequence length	247
Interactions	View interactions