CELF2-AS1 (CELF2 antisense RNA 1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 414196
Gene name CELF2 antisense RNA 1
Gene symbol CELF2-AS1
Synonyms (NCBI Gene)
C10orf31
Chromosome 10
Chromosome location 10p14
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 23515 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N7Q2
Protein name Putative uncharacterized protein CELF2-AS1 (CELF2 antisense RNA 1) (CELF2 antisense gene protein 1)
Family and domains
Sequence 
MFCLLHLCFYLANFASSIKRTHAVNGCCGLQMIALWAQSSGNADARVEEILAGEERRLAA
LLGSQGMRFWVCLAACRAMWGLAARRGRAEDSSSSPVDASKFPWRGGQHRTTMMPCLLRV
GVFRPCHVRPTGDPSCDVQPPRLGFSRVPDTQVAFYGSGHWDPTPFSVHSCFFNFQVRKI
IFLL
Sequence length 184
Interactions View interactions

No strongly related genes found yet for CELF2-AS1.

No additional diseases found yet through genes similar to CELF2-AS1.