Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	51032
Gene name	Chymotrypsin like elastase 2B
Gene symbol	CELA2B
Synonyms (NCBI Gene)	ELA2B
Chromosome	1
Chromosome location	1p36.21
Summary	Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase

14 Show/Hide all (14)

miRTarBase ID	miRNA	Experiments
MIRT883633	hsa-miR-132	CLIP-seq
MIRT883634	hsa-miR-153	CLIP-seq
MIRT883635	hsa-miR-1915	CLIP-seq
MIRT883636	hsa-miR-212	CLIP-seq
MIRT883637	hsa-miR-3691-3p	CLIP-seq
MIRT883638	hsa-miR-369-3p	CLIP-seq
MIRT883639	hsa-miR-374a	CLIP-seq
MIRT883640	hsa-miR-374b	CLIP-seq
MIRT883641	hsa-miR-410	CLIP-seq
MIRT883642	hsa-miR-448	CLIP-seq
MIRT883643	hsa-miR-4726-3p	CLIP-seq
MIRT883644	hsa-miR-4766-5p	CLIP-seq
MIRT883645	hsa-miR-494	CLIP-seq
MIRT883646	hsa-miR-668	CLIP-seq

12 Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	TAS	3427074
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	3646943
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA

MIM	HGNC	e!Ensembl
609444	29995	ENSG00000215704

P08218

Protein name

Chymotrypsin-like elastase family member 2B (EC 3.4.21.71) (Elastase-2B)

Protein function

Acts upon elastin.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	29 → 262	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Pancreas.

Sequence

MIRTLLLSTLVAGALSCGVSTYAPDMSRMLGGEEARPNSWPWQVSLQYSSNGQWYHTCGG
SLIANSWVLTAAHCISSSGIYRVMLGQHNLYVAESGSLAVSVSKIVVHKDWNSDQVSKGN
DIALLKLANPVSLTDKIQLACLPPAGTILPNNYPCYVTGWGRLQTNGALPDDLKQGQLLV
VDYATCSSSGWWGSTVKTNMICAGGDGVICTCNGDSGGPLNCQASDGRWEVHGIGSLTSV
LGCNYYYKPSIFTRVSNYNDWINSVIANN

Sequence length

269

Interactions

View interactions

KEGG Pathway
Pancreatic secretion
Protein digestion and absorption

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ERECTILE DYSFUNCTION	—	GWAS catalog	20932654	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33462484	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	20932654	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	30237584	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

CELA2B (chymotrypsin like elastase 2B)

Bookmark This Gene