CEBPZOS (CEBPZ opposite strand)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100505876
Gene name CEBPZ opposite strand
Gene symbol CEBPZOS
Synonyms (NCBI Gene)
CEBPZ-AS1
Chromosome 2
Chromosome location 2p22.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0016020 Component Membrane IEA
GO:0031966 Component Mitochondrial membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MTT3
Protein name Protein CEBPZOS (CEBPZ antisense RNA 1) (CEBPZ opposite strand)
Family and domains
Sequence 
MARTLEPLAKKIFKGVLVAELVGVFGAYFLFSKMHTSQDFRQTMSKKYPFILEVYYKSTE
KSGMYGIRELDQKTWLNSKN
Sequence length 80
Interactions View interactions

No strongly related genes found yet for CEBPZOS.

No additional diseases found yet through genes similar to CEBPZOS.