CEACAM20 (CEA cell adhesion molecule 20)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 125931
• Gene name: CEA cell adhesion molecule 20
• Gene symbol: CEACAM20
• Synonyms (NCBI Gene): UNQ9366
• Chromosome: 19
• Chromosome location: 19q13.31

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002682	Process	Regulation of immune system process	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0009617	Process	Response to bacterium	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0031528	Component	Microvillus membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q6UY09
• Protein name: Cell adhesion molecule CEACAM20 (Carcinoembryonic antigen-related cell adhesion molecule 20) (CEA cell adhesion molecule 20)
• Protein function: Together with the tyrosine-protein kinase SYK, enhances production of the cytokine CXCL8/IL-8 via the NFKB pathway and may thus have a role in the intestinal immune response.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13927	Ig_3	69 → 142		Domain
  PF13927	Ig_3	255 → 328		Domain
  PF13927	Ig_3	351 → 420		Domain

• Sequence:

  MGPADSWGHHWMGILLSASLCTVWSPPAAAQLTLNANPLDATQSEDVVLPVFGTPRTPQI
  HGRSRELAKPSIAVSPGTAIEQKDMVTFYCTTKDVNITIHWVSNNLSIVFHERMQLSKDG
  KILTILIVQREDSGTYQCEARDALLSQRSDPIFLDVKYGPDPVEIKLESGVASGEVVEVM
  EGSSMTFLAETKSHPPCAYTWFLLDSILSHTTRTFTIHAVSREHEGLYRCLVSNSATHLS
  SLGTLKVRVLETLTMPQVVPSSLNLVENARSVDLTCQTVNQSVNVQWFLSGQPLLPSEHL
  QLSADNRTLIIHGLQRNDTGPYACEVWNWGSRARSEPLELTINYGPDQVHITRESASEMI
  STIEAELNSSLTLQCWAESKPGAEYRWTLEHSTGEHLGEQLIIRALTWEHDGIYNCTASN
  SLTGLARSTSVLVKVVGPQSSSLSSGAIAGIVIGILAVIAVASELGYFLCIRNARRPSRK
  TTEDPSHETSQPIPKEEHPTEPSSESLSPEYRNISQLQGRIRVELMQPPDLPEETYETKL
  PSASRRGNSFSPWKPPPKPLMPPLRLVSTVPKNMESIYEELVNPEPNTYIQINPSV

• Sequence length: 596

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	29777097, 30617256, 35589863, 39537608	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, EHRLICH TUMOR	—	CTD	34605108	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	29777097, 30617256		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASDB_DG	23422753		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	26195794		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34629822	Stimulate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CEACAM20.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CEACAM20.