CDX4 (caudal type homeobox 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1046
• Gene name: Caudal type homeobox 4
• Gene symbol: CDX4
• Synonyms (NCBI Gene): -
• Chromosome: X
• Chromosome location: Xq13.2
• Summary: This gene encodes a member of a small subfamily of homeobox containing transcription factors. The encoded protein may regulate homeobox gene expression during anteroposterior patterning and hematopoiesis. [provided by RefSeq, Aug 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017920	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	21471217
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	21471217
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	21471217
GO:0001568	Process	Blood vessel development	IEA
GO:0001890	Process	Placenta development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0005515	Function	Protein binding	IPI	24722188, 25416956, 26871637, 31515488, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0009880	Process	Embryonic pattern specification	IBA
GO:0009948	Process	Anterior/posterior axis specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	21471217
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	21471217
GO:0048565	Process	Digestive tract development	IBA
GO:0060711	Process	Labyrinthine layer development	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 300025
• HGNC: 1808
• e!Ensembl: ENSG00000131264

Protein

• UniProt ID: O14627
• Protein name: Homeobox protein CDX-4 (Caudal-type homeobox protein 4)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	174 → 230	Homeodomain	Domain
  PF04731	Caudal_act	13 → 170	Caudal like protein activation region	Family

• Sequence:

  MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMP
  SMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVG
  GGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVVY
  TDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFE
  NSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE

• Sequence length: 284

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
CDX4-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	31770439		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	17068127		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	33021557	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17068127		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17068127, 17855634, 17881901, 21471217, 27340869		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	22901255		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17342311		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CDX4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CDX4.