CDPF1 (cysteine rich DPF motif domain containing 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 150383 |
| Gene name | Cysteine rich DPF motif domain containing 1 |
| Gene symbol | CDPF1 |
| Synonyms (NCBI Gene) |
C22orf40CDKN1A
|
| Chromosome | 22 |
| Chromosome location | 22q13.31 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q6NVV7 | ||||||||||
| Protein name | Cysteine-rich DPF motif domain-containing protein 1 | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MASHVECRPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSDKDRFLVL |
||||||||||
| Sequence length | 123 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with CDPF1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to CDPF1 (see Related Genes above), that are NOT already directly curated for CDPF1 itself -- a lead worth checking, not a confirmed association.
0
|
|