CDKN2A-AS1 (CDKN2A antisense RNA 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 51198 |
| Gene name | CDKN2A antisense RNA 1 |
| Gene symbol | CDKN2A-AS1 |
| Synonyms (NCBI Gene) |
C9orf53CDKN2A-DTbA149I2.3
|
| Chromosome | 9 |
| Chromosome location | 9p21.3 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9UH64 |
| Protein name | Putative uncharacterized protein CDKN2A-AS1 (CDKN2A antisense RNA 1) (CDKN2A antisense gene protein 1) (Protein CDKN2A-DT) (Susceptibility protein NSG-x) |
| Family and domains | |
| Sequence |
MRQRGQEHLPTSVKSEPRACNNPTVAENRRVPSGLAAVIRNLTALWNPSLGVSERRGGDW |
| Sequence length | 79 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with CDKN2A-AS1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to CDKN2A-AS1 (see Related Genes above), that are NOT already directly curated for CDKN2A-AS1 itself -- a lead worth checking, not a confirmed association.
0
|
|