Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	1027
Gene name	Cyclin dependent kinase inhibitor 1B
Gene symbol	CDKN1B
Synonyms (NCBI Gene)	CDKN4KIP1MEN1BMEN4P27KIP1
Chromosome	12
Chromosome location	12p13.1
Summary	This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle

1094

Show/Hide all (1094)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blot	17569667
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blot	17569667
MIRT000131	hsa-miR-222-3p	Luciferase reporter assayWestern blot	17569667
MIRT000131	hsa-miR-222-3p	Luciferase reporter assayWestern blot	17569667
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blot	18413744
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blot	18413744
MIRT000131	hsa-miR-222-3p	Luciferase reporter assayWestern blot	18413744
MIRT000131	hsa-miR-222-3p	Luciferase reporter assayWestern blot	18413744
MIRT000137	hsa-miR-221-3p	qRT-PCRLuciferase reporter assayWestern blot	19153141
MIRT000131	hsa-miR-222-3p	qRT-PCRLuciferase reporter assayWestern blot	19153141
MIRT000137	hsa-miR-221-3p	Western blotNorthern blot	19107213
MIRT000137	hsa-miR-221-3p	Western blotNorthern blot	19107213
MIRT000131	hsa-miR-222-3p	Western blotNorthern blot	19107213
MIRT000131	hsa-miR-222-3p	Western blotNorthern blot	19107213
MIRT006589	hsa-miR-221-3p	qRT-PCRLuciferase reporter assayWestern blot	19749093
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blot	19859555
MIRT000131	hsa-miR-222-3p	Luciferase reporter assayWestern blot	19859555
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	19150885
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	18834855
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	19153141
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	18246122
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	18983236
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	18521080
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	17569667
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	19859555
MIRT000137	hsa-miR-221-3p	Luciferase reporter assay	19749093
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	19150885
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	19153141
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	18246122
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	18983236
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17569667
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	19859555
MIRT004554	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	19273599
MIRT004554	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	19273599
MIRT004554	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	19273599
MIRT004554	hsa-miR-181a-5p	Luciferase reporter assayWestern blot	19273599
MIRT000137	hsa-miR-221-3p	Review	19815577
MIRT000131	hsa-miR-222-3p	Review	19815577
MIRT000137	hsa-miR-221-3p	immunohistochemistryMicroarrayqRT-PCR	20012062
MIRT000131	hsa-miR-222-3p	immunohistochemistryMicroarrayqRT-PCR	20012062
MIRT000137	hsa-miR-221-3p	Review	20130964
MIRT000131	hsa-miR-222-3p	Review	20130964
MIRT000137	hsa-miR-221-3p	Northern blotqRT-PCRWestern blot	20018759
MIRT000131	hsa-miR-222-3p	Northern blotqRT-PCRWestern blot	20018759
MIRT000131	hsa-miR-222-3p	Northern blotqRT-PCRWestern blot	20018759
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayqRT-PCRWestern blot	18417445
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayqRT-PCRWestern blot	18417445
MIRT000131	hsa-miR-222-3p	Luciferase reporter assayqRT-PCRWestern blot	18417445
MIRT000131	hsa-miR-222-3p	Luciferase reporter assayqRT-PCRWestern blot	18417445
MIRT000137	hsa-miR-221-3p	qRT-PCRWestern blot	18708351
MIRT000131	hsa-miR-222-3p	qRT-PCRWestern blot	18708351
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayqRT-PCRWestern blot	19088079
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blot	17627278
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blot	17627278
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17627278
MIRT000131	hsa-miR-222-3p	Luciferase reporter assay	17627278
MIRT005063	hsa-miR-24-3p	Luciferase reporter assay	17627278
MIRT005064	hsa-miR-192-5p	Luciferase reporter assay	17627278
MIRT005065	hsa-miR-196a-5p	Luciferase reporter assay	17627278
MIRT005066	hsa-miR-190a-5p	Luciferase reporter assay	17627278
MIRT005067	hsa-miR-218-5p	Luciferase reporter assay	17627278
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayqRT-PCRWestern blot	17721077
MIRT000131	hsa-miR-222-3p	Western blot	17721077
MIRT000137	hsa-miR-221-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayNorthern blotWestern blot	19424584
MIRT000137	hsa-miR-221-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayNorthern blotWestern blot	19424584
MIRT000137	hsa-miR-221-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayNorthern blotWestern blot	19424584
MIRT000131	hsa-miR-222-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayNorthern blotWestern blot	19424584
MIRT000131	hsa-miR-222-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayNorthern blotWestern blot	19424584
MIRT000131	hsa-miR-222-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayNorthern blotWestern blot	19424584
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blot	18155131
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blot	18155131
MIRT005063	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	20816961
MIRT000131	hsa-miR-222-3p	qRT-PCR	23447020
MIRT000131	hsa-miR-222-3p	Reporter assay;Western blot	19424584
MIRT000131	hsa-miR-222-3p	Western blot;Other	17569667
MIRT000131	hsa-miR-222-3p	Reporter assay	17721077
MIRT000131	hsa-miR-222-3p	Reporter assay	17914108
MIRT000131	hsa-miR-222-3p	Northern blot	17569667
MIRT000131	hsa-miR-222-3p	Reporter assay	18413744
MIRT000137	hsa-miR-221-3p	Reporter assay;Western blot	19424584
MIRT000137	hsa-miR-221-3p	Sequencing	20371350
MIRT000137	hsa-miR-221-3p	Reporter assay	17914108
MIRT000137	hsa-miR-221-3p	Northern blot;Western blot	17569667
MIRT000137	hsa-miR-221-3p	Reporter assay	17721077
MIRT000137	hsa-miR-221-3p	Reporter assay	18413744
MIRT004554	hsa-miR-181a-5p	Reporter assay;Western blot;qRT-PCR	19273599
MIRT027709	hsa-miR-98-5p	Microarray	19088304
MIRT005063	hsa-miR-24-3p	Sequencing	20371350
MIRT005063	hsa-miR-24-3p	Microarray	19748357
MIRT005063	hsa-miR-24-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	23553486
MIRT004554	hsa-miR-181a-5p	CLASH	23622248
MIRT052676	hsa-miR-1260b	CLASH	23622248
MIRT000131	hsa-miR-222-3p	ImmunofluorescenceLuciferase reporter assayWestern blot	24137356
MIRT005065	hsa-miR-196a-5p	and SGC-7901 and the normal gastric epithelium cell line (GES-1)"	22343731
MIRT005065	hsa-miR-196a-5p	and SGC-7901 and the normal gastric epithelium cell line (GES-1)"	22343731
MIRT053475	hsa-miR-148a-3p	In situ hybridizationLuciferase reporter assayNorthern blotWestern blot	21552422
MIRT005065	hsa-miR-196a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	22343731
MIRT005065	hsa-miR-196a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	22343731
MIRT054250	hsa-miR-194-5p	ImmunohistochemistryImmunoprecipitationLuciferase reporter assayQRTPCRWestren Blot	23584484
MIRT000137	hsa-miR-221-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24586944
MIRT005065	hsa-miR-196a-5p	Luciferase reporter assayqRT-PCRWestern blot	24423924
MIRT437459	hsa-miR-182-5p	Luciferase reporter assay	23249749
MIRT000137	hsa-miR-221-3p	FlowLuciferase reporter assayqRT-PCRWestern blot	25436097
MIRT437988	hsa-miR-200b-3p	Luciferase reporter assay	24151081
MIRT438015	hsa-miR-452-5p	Luciferase reporter assayWestern blot	24381057
MIRT438015	hsa-miR-452-5p	Luciferase reporter assayWestern blot	24381057
MIRT437988	hsa-miR-200b-3p	qRT-PCRLuciferase reporter assayWestern blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCRLuciferase reporter assayWestern blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCRLuciferase reporter assayWestern blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCRLuciferase reporter assayWestern blot	24667864
MIRT437988	hsa-miR-200b-3p	Luciferase reporter assay	24151081
MIRT438015	hsa-miR-452-5p	Luciferase reporter assayWestern blot	24381057
MIRT438015	hsa-miR-452-5p	Luciferase reporter assayWestern blot	24381057
MIRT437988	hsa-miR-200b-3p	qRT-PCRLuciferase reporter assayWestern blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCRLuciferase reporter assayWestern blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCRLuciferase reporter assayWestern blot	24667864
MIRT437988	hsa-miR-200b-3p	qRT-PCRLuciferase reporter assayWestern blot	24667864
MIRT479437	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT479436	hsa-miR-302f	PAR-CLIP	20371350
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT479427	hsa-miR-1827	PAR-CLIP	20371350
MIRT479425	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT479423	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT479421	hsa-miR-448	PAR-CLIP	20371350
MIRT479420	hsa-miR-1303	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT000131	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT479412	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT479411	hsa-miR-548ac	PAR-CLIP	20371350
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT479407	hsa-miR-548z	PAR-CLIP	20371350
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT479399	hsa-miR-548m	PAR-CLIP	20371350
MIRT479398	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT479397	hsa-miR-548ag	PAR-CLIP	20371350
MIRT479396	hsa-miR-548ai	PAR-CLIP	20371350
MIRT479395	hsa-miR-548ba	PAR-CLIP	20371350
MIRT479394	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT479393	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT479391	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT479390	hsa-miR-548v	PAR-CLIP	20371350
MIRT568108	hsa-miR-892c-3p	PAR-CLIP	20371350
MIRT568107	hsa-miR-4676-3p	PAR-CLIP	20371350
MIRT438015	hsa-miR-452-5p	PAR-CLIP	20371350
MIRT568106	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT437988	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT568105	hsa-miR-429	PAR-CLIP	20371350
MIRT568104	hsa-miR-7151-5p	PAR-CLIP	20371350
MIRT568103	hsa-miR-7852-3p	PAR-CLIP	20371350
MIRT568102	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT479437	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT479427	hsa-miR-1827	PAR-CLIP	20371350
MIRT479425	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT479423	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT479421	hsa-miR-448	PAR-CLIP	20371350
MIRT479420	hsa-miR-1303	PAR-CLIP	20371350
MIRT479418	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT005065	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT479417	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT479415	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT479416	hsa-miR-3148	PAR-CLIP	20371350
MIRT479414	hsa-miR-4672	PAR-CLIP	20371350
MIRT479413	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT000131	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT479412	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT479411	hsa-miR-548ac	PAR-CLIP	20371350
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT479407	hsa-miR-548z	PAR-CLIP	20371350
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT479399	hsa-miR-548m	PAR-CLIP	20371350
MIRT479398	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT479397	hsa-miR-548ag	PAR-CLIP	20371350
MIRT479396	hsa-miR-548ai	PAR-CLIP	20371350
MIRT479395	hsa-miR-548ba	PAR-CLIP	20371350
MIRT479394	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT479393	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT479391	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT479390	hsa-miR-548v	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	21572407
MIRT000131	hsa-miR-222-3p	PAR-CLIP	21572407
MIRT479412	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT479411	hsa-miR-548ac	PAR-CLIP	21572407
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT479407	hsa-miR-548z	PAR-CLIP	21572407
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT479399	hsa-miR-548m	PAR-CLIP	21572407
MIRT479398	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT479397	hsa-miR-548ag	PAR-CLIP	21572407
MIRT479396	hsa-miR-548ai	PAR-CLIP	21572407
MIRT479395	hsa-miR-548ba	PAR-CLIP	21572407
MIRT479394	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT479393	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	21572407
MIRT479391	hsa-miR-187-5p	PAR-CLIP	21572407
MIRT479390	hsa-miR-548v	PAR-CLIP	21572407
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	21572407
MIRT541377	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT541376	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT494319	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT494318	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT053475	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT541375	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT541374	hsa-miR-1265	PAR-CLIP	21572407
MIRT541373	hsa-miR-8060	PAR-CLIP	21572407
MIRT541372	hsa-miR-219b-5p	PAR-CLIP	21572407
MIRT541371	hsa-let-7a-3p	PAR-CLIP	21572407
MIRT541370	hsa-let-7b-3p	PAR-CLIP	21572407
MIRT541369	hsa-let-7f-1-3p	PAR-CLIP	21572407
MIRT541368	hsa-miR-98-3p	PAR-CLIP	21572407
MIRT541367	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT541366	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT541365	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT494312	hsa-miR-4276	PAR-CLIP	21572407
MIRT541364	hsa-miR-5581-3p	PAR-CLIP	21572407
MIRT541363	hsa-miR-3912-5p	PAR-CLIP	21572407
MIRT494310	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT494309	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT494308	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT494307	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT479437	hsa-miR-877-5p	PAR-CLIP	22012620
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	22012620
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	22012620
MIRT479427	hsa-miR-1827	PAR-CLIP	22012620
MIRT479425	hsa-miR-155-5p	PAR-CLIP	22012620
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	22012620
MIRT479423	hsa-miR-153-3p	PAR-CLIP	22012620
MIRT479421	hsa-miR-448	PAR-CLIP	22012620
MIRT479420	hsa-miR-1303	PAR-CLIP	22012620
MIRT000137	hsa-miR-221-3p	PAR-CLIP	22012620
MIRT000131	hsa-miR-222-3p	PAR-CLIP	22012620
MIRT479412	hsa-miR-455-5p	PAR-CLIP	22012620
MIRT479411	hsa-miR-548ac	PAR-CLIP	22012620
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	22012620
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	22012620
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	22012620
MIRT479407	hsa-miR-548z	PAR-CLIP	22012620
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT479399	hsa-miR-548m	PAR-CLIP	22012620
MIRT479398	hsa-miR-561-3p	PAR-CLIP	22012620
MIRT479397	hsa-miR-548ag	PAR-CLIP	22012620
MIRT479396	hsa-miR-548ai	PAR-CLIP	22012620
MIRT479395	hsa-miR-548ba	PAR-CLIP	22012620
MIRT479394	hsa-miR-570-5p	PAR-CLIP	22012620
MIRT479393	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT538590	hsa-miR-5088-3p	PAR-CLIP	22012620
MIRT538589	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT538588	hsa-miR-4287	PAR-CLIP	22012620
MIRT538587	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT479391	hsa-miR-187-5p	PAR-CLIP	22012620
MIRT479390	hsa-miR-548v	PAR-CLIP	22012620
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	22012620
MIRT479437	hsa-miR-877-5p	PAR-CLIP	23446348
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT479427	hsa-miR-1827	PAR-CLIP	23446348
MIRT479425	hsa-miR-155-5p	PAR-CLIP	23446348
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	23446348
MIRT479423	hsa-miR-153-3p	PAR-CLIP	23446348
MIRT479421	hsa-miR-448	PAR-CLIP	23446348
MIRT479420	hsa-miR-1303	PAR-CLIP	23446348
MIRT000137	hsa-miR-221-3p	PAR-CLIP	23446348
MIRT000131	hsa-miR-222-3p	PAR-CLIP	23446348
MIRT479412	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT479411	hsa-miR-548ac	PAR-CLIP	23446348
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT479407	hsa-miR-548z	PAR-CLIP	23446348
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT479399	hsa-miR-548m	PAR-CLIP	23446348
MIRT479397	hsa-miR-548ag	PAR-CLIP	23446348
MIRT479396	hsa-miR-548ai	PAR-CLIP	23446348
MIRT479395	hsa-miR-548ba	PAR-CLIP	23446348
MIRT479394	hsa-miR-570-5p	PAR-CLIP	23446348
MIRT479391	hsa-miR-187-5p	PAR-CLIP	23446348
MIRT479390	hsa-miR-548v	PAR-CLIP	23446348
MIRT507809	hsa-miR-4463	PAR-CLIP	23446348
MIRT507808	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT507807	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT507806	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT507805	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT507804	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT507802	hsa-miR-4464	PAR-CLIP	23446348
MIRT507803	hsa-miR-4748	PAR-CLIP	23446348
MIRT507801	hsa-miR-329-5p	PAR-CLIP	23446348
MIRT507800	hsa-miR-4667-5p	PAR-CLIP	23446348
MIRT507799	hsa-miR-4700-5p	PAR-CLIP	23446348
MIRT507798	hsa-miR-8089	PAR-CLIP	23446348
MIRT507797	hsa-miR-1267	PAR-CLIP	23446348
MIRT507796	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT507795	hsa-miR-1185-5p	PAR-CLIP	23446348
MIRT507794	hsa-miR-3679-5p	PAR-CLIP	23446348
MIRT507793	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT507792	hsa-miR-3616-3p	PAR-CLIP	23446348
MIRT507791	hsa-miR-3140-3p	PAR-CLIP	23446348
MIRT507790	hsa-miR-5191	PAR-CLIP	23446348
MIRT507789	hsa-miR-34a-5p	PAR-CLIP	23446348
MIRT507788	hsa-miR-34c-5p	PAR-CLIP	23446348
MIRT507787	hsa-miR-449a	PAR-CLIP	23446348
MIRT507786	hsa-miR-449b-5p	PAR-CLIP	23446348
MIRT507785	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT507784	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT507783	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT507782	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT507781	hsa-miR-3175	PAR-CLIP	23446348
MIRT507780	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT507779	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT507778	hsa-miR-6825-5p	PAR-CLIP	23446348
MIRT507777	hsa-miR-3150a-3p	PAR-CLIP	23446348
MIRT507776	hsa-miR-6763-5p	PAR-CLIP	23446348
MIRT507775	hsa-miR-4743-3p	PAR-CLIP	23446348
MIRT507774	hsa-miR-4652-3p	PAR-CLIP	23446348
MIRT507773	hsa-miR-3147	PAR-CLIP	23446348
MIRT494319	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT494318	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT053475	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT494317	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT494316	hsa-miR-4282	PAR-CLIP	23592263
MIRT494315	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT479432	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT479431	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT479430	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT494314	hsa-miR-4255	PAR-CLIP	23592263
MIRT479426	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT494313	hsa-miR-5701	PAR-CLIP	23592263
MIRT494312	hsa-miR-4276	PAR-CLIP	23592263
MIRT494311	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT494310	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT494309	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT494308	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT494307	hsa-miR-335-3p	PAR-CLIP	23592263
MIRT479437	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479436	hsa-miR-302f	PAR-CLIP	23592263
MIRT479435	hsa-miR-5694	PAR-CLIP	23592263
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT479432	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT479431	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT479430	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT479429	hsa-miR-1288-5p	PAR-CLIP	23592263
MIRT479428	hsa-miR-4729	PAR-CLIP	23592263
MIRT479427	hsa-miR-1827	PAR-CLIP	23592263
MIRT479426	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT479425	hsa-miR-155-5p	PAR-CLIP	23592263
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	23592263
MIRT479422	hsa-miR-5696	PAR-CLIP	23592263
MIRT479423	hsa-miR-153-3p	PAR-CLIP	23592263
MIRT479421	hsa-miR-448	PAR-CLIP	23592263
MIRT479419	hsa-miR-3658	PAR-CLIP	23592263
MIRT479420	hsa-miR-1303	PAR-CLIP	23592263
MIRT479418	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT005065	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT479417	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479415	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT479416	hsa-miR-3148	PAR-CLIP	23592263
MIRT479414	hsa-miR-4672	PAR-CLIP	23592263
MIRT479413	hsa-miR-4789-5p	PAR-CLIP	23592263
MIRT000137	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT000131	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT479412	hsa-miR-455-5p	PAR-CLIP	23592263
MIRT479411	hsa-miR-548ac	PAR-CLIP	23592263
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT479407	hsa-miR-548z	PAR-CLIP	23592263
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	23592263
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	23592263
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	23592263
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	23592263
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	23592263
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	23592263
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	23592263
MIRT479399	hsa-miR-548m	PAR-CLIP	23592263
MIRT479398	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT479397	hsa-miR-548ag	PAR-CLIP	23592263
MIRT479396	hsa-miR-548ai	PAR-CLIP	23592263
MIRT479395	hsa-miR-548ba	PAR-CLIP	23592263
MIRT479394	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT479393	hsa-miR-186-3p	PAR-CLIP	23592263
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	23592263
MIRT479391	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT479390	hsa-miR-548v	PAR-CLIP	23592263
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	23592263
MIRT005063	hsa-miR-24-3p	Luciferase reporter assay	26847530
MIRT005063	hsa-miR-24-3p	Luciferase reporter assay	26847530
MIRT732308	hsa-miR-148a-5p	Luciferase reporter assayWestern blot	27292025
MIRT732308	hsa-miR-148a-5p	Luciferase reporter assayWestern blot	27292025
MIRT004554	hsa-miR-181a-5p	qRT-PCRWestern blot	27534652
MIRT005063	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	26044523
MIRT053475	hsa-miR-148a-3p	Luciferase reporter assayWestern blot	27842905
MIRT053475	hsa-miR-148a-3p	Luciferase reporter assayWestern blot	27842905
MIRT479418	hsa-miR-196b-5p	Luciferase reporter assayWestern blottingqRT-PCR	33842615
MIRT000137	hsa-miR-221-3p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)ImmunofluorescenceIn situ hybridizationFlow cytometry	32590883
MIRT000131	hsa-miR-222-3p	Luciferase reporter assayWestern blottingqRT-PCR	33312752
MIRT736321	hsa-miR-150-5p	Luciferase reporter assayWestern blottingqRT-PCR	32963616
MIRT736561	hsa-miR-575	Luciferase reporter assayWestern blottingqRT-PCR	32929377
MIRT438015	hsa-miR-452-5p	Luciferase reporter assayRNA-seqqRT-PCR	31933800
MIRT479437	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT479436	hsa-miR-302f	PAR-CLIP	20371350
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT479427	hsa-miR-1827	PAR-CLIP	20371350
MIRT479425	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT479423	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT479421	hsa-miR-448	PAR-CLIP	20371350
MIRT479420	hsa-miR-1303	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT000131	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT479412	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT479411	hsa-miR-548ac	PAR-CLIP	20371350
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT479407	hsa-miR-548z	PAR-CLIP	20371350
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT479399	hsa-miR-548m	PAR-CLIP	20371350
MIRT479398	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT479397	hsa-miR-548ag	PAR-CLIP	20371350
MIRT479396	hsa-miR-548ai	PAR-CLIP	20371350
MIRT479395	hsa-miR-548ba	PAR-CLIP	20371350
MIRT479394	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT479393	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT479391	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT479390	hsa-miR-548v	PAR-CLIP	20371350
MIRT568108	hsa-miR-892c-3p	PAR-CLIP	20371350
MIRT568107	hsa-miR-4676-3p	PAR-CLIP	20371350
MIRT438015	hsa-miR-452-5p	PAR-CLIP	20371350
MIRT568106	hsa-miR-200c-3p	PAR-CLIP	20371350
MIRT437988	hsa-miR-200b-3p	PAR-CLIP	20371350
MIRT568105	hsa-miR-429	PAR-CLIP	20371350
MIRT568104	hsa-miR-7151-5p	PAR-CLIP	20371350
MIRT568103	hsa-miR-7852-3p	PAR-CLIP	20371350
MIRT568102	hsa-miR-4742-5p	PAR-CLIP	20371350
MIRT479437	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT479427	hsa-miR-1827	PAR-CLIP	20371350
MIRT479425	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT479423	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT479421	hsa-miR-448	PAR-CLIP	20371350
MIRT479420	hsa-miR-1303	PAR-CLIP	20371350
MIRT479418	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT005065	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT479417	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT479415	hsa-miR-6768-5p	PAR-CLIP	20371350
MIRT479416	hsa-miR-3148	PAR-CLIP	20371350
MIRT479414	hsa-miR-4672	PAR-CLIP	20371350
MIRT479413	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	20371350
MIRT000131	hsa-miR-222-3p	PAR-CLIP	20371350
MIRT479412	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT479411	hsa-miR-548ac	PAR-CLIP	20371350
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT479407	hsa-miR-548z	PAR-CLIP	20371350
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT479399	hsa-miR-548m	PAR-CLIP	20371350
MIRT479398	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT479397	hsa-miR-548ag	PAR-CLIP	20371350
MIRT479396	hsa-miR-548ai	PAR-CLIP	20371350
MIRT479395	hsa-miR-548ba	PAR-CLIP	20371350
MIRT479394	hsa-miR-570-5p	PAR-CLIP	20371350
MIRT479393	hsa-miR-186-3p	PAR-CLIP	20371350
MIRT479391	hsa-miR-187-5p	PAR-CLIP	20371350
MIRT479390	hsa-miR-548v	PAR-CLIP	20371350
MIRT000137	hsa-miR-221-3p	PAR-CLIP	21572407
MIRT000131	hsa-miR-222-3p	PAR-CLIP	21572407
MIRT479412	hsa-miR-455-5p	PAR-CLIP	21572407
MIRT479411	hsa-miR-548ac	PAR-CLIP	21572407
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	21572407
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	21572407
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	21572407
MIRT479407	hsa-miR-548z	PAR-CLIP	21572407
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	21572407
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	21572407
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	21572407
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	21572407
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	21572407
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	21572407
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	21572407
MIRT479399	hsa-miR-548m	PAR-CLIP	21572407
MIRT479398	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT479397	hsa-miR-548ag	PAR-CLIP	21572407
MIRT479396	hsa-miR-548ai	PAR-CLIP	21572407
MIRT479395	hsa-miR-548ba	PAR-CLIP	21572407
MIRT479394	hsa-miR-570-5p	PAR-CLIP	21572407
MIRT479393	hsa-miR-186-3p	PAR-CLIP	21572407
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	21572407
MIRT479391	hsa-miR-187-5p	PAR-CLIP	21572407
MIRT479390	hsa-miR-548v	PAR-CLIP	21572407
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	21572407
MIRT541377	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT541376	hsa-miR-520f-3p	PAR-CLIP	21572407
MIRT494319	hsa-miR-148b-3p	PAR-CLIP	21572407
MIRT494318	hsa-miR-152-3p	PAR-CLIP	21572407
MIRT053475	hsa-miR-148a-3p	PAR-CLIP	21572407
MIRT541375	hsa-miR-4700-3p	PAR-CLIP	21572407
MIRT541374	hsa-miR-1265	PAR-CLIP	21572407
MIRT541373	hsa-miR-8060	PAR-CLIP	21572407
MIRT541372	hsa-miR-219b-5p	PAR-CLIP	21572407
MIRT541371	hsa-let-7a-3p	PAR-CLIP	21572407
MIRT541370	hsa-let-7b-3p	PAR-CLIP	21572407
MIRT541369	hsa-let-7f-1-3p	PAR-CLIP	21572407
MIRT541368	hsa-miR-98-3p	PAR-CLIP	21572407
MIRT541367	hsa-let-7f-2-3p	PAR-CLIP	21572407
MIRT541366	hsa-miR-1185-1-3p	PAR-CLIP	21572407
MIRT541365	hsa-miR-1185-2-3p	PAR-CLIP	21572407
MIRT494312	hsa-miR-4276	PAR-CLIP	21572407
MIRT541364	hsa-miR-5581-3p	PAR-CLIP	21572407
MIRT541363	hsa-miR-3912-5p	PAR-CLIP	21572407
MIRT494310	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT494309	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT494308	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT494307	hsa-miR-335-3p	PAR-CLIP	21572407
MIRT479437	hsa-miR-877-5p	PAR-CLIP	22012620
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	22012620
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	22012620
MIRT479427	hsa-miR-1827	PAR-CLIP	22012620
MIRT479425	hsa-miR-155-5p	PAR-CLIP	22012620
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	22012620
MIRT479423	hsa-miR-153-3p	PAR-CLIP	22012620
MIRT479421	hsa-miR-448	PAR-CLIP	22012620
MIRT479420	hsa-miR-1303	PAR-CLIP	22012620
MIRT000137	hsa-miR-221-3p	PAR-CLIP	22012620
MIRT000131	hsa-miR-222-3p	PAR-CLIP	22012620
MIRT479412	hsa-miR-455-5p	PAR-CLIP	22012620
MIRT479411	hsa-miR-548ac	PAR-CLIP	22012620
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	22012620
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	22012620
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	22012620
MIRT479407	hsa-miR-548z	PAR-CLIP	22012620
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT479399	hsa-miR-548m	PAR-CLIP	22012620
MIRT479398	hsa-miR-561-3p	PAR-CLIP	22012620
MIRT479397	hsa-miR-548ag	PAR-CLIP	22012620
MIRT479396	hsa-miR-548ai	PAR-CLIP	22012620
MIRT479395	hsa-miR-548ba	PAR-CLIP	22012620
MIRT479394	hsa-miR-570-5p	PAR-CLIP	22012620
MIRT479393	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT538590	hsa-miR-5088-3p	PAR-CLIP	22012620
MIRT538589	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT538588	hsa-miR-4287	PAR-CLIP	22012620
MIRT538587	hsa-miR-4685-3p	PAR-CLIP	22012620
MIRT479391	hsa-miR-187-5p	PAR-CLIP	22012620
MIRT479390	hsa-miR-548v	PAR-CLIP	22012620
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	22012620
MIRT479437	hsa-miR-877-5p	PAR-CLIP	23446348
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT479427	hsa-miR-1827	PAR-CLIP	23446348
MIRT479425	hsa-miR-155-5p	PAR-CLIP	23446348
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	23446348
MIRT479423	hsa-miR-153-3p	PAR-CLIP	23446348
MIRT479421	hsa-miR-448	PAR-CLIP	23446348
MIRT479420	hsa-miR-1303	PAR-CLIP	23446348
MIRT000137	hsa-miR-221-3p	PAR-CLIP	23446348
MIRT000131	hsa-miR-222-3p	PAR-CLIP	23446348
MIRT479412	hsa-miR-455-5p	PAR-CLIP	23446348
MIRT479411	hsa-miR-548ac	PAR-CLIP	23446348
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT479407	hsa-miR-548z	PAR-CLIP	23446348
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT479399	hsa-miR-548m	PAR-CLIP	23446348
MIRT479397	hsa-miR-548ag	PAR-CLIP	23446348
MIRT479396	hsa-miR-548ai	PAR-CLIP	23446348
MIRT479395	hsa-miR-548ba	PAR-CLIP	23446348
MIRT479394	hsa-miR-570-5p	PAR-CLIP	23446348
MIRT479391	hsa-miR-187-5p	PAR-CLIP	23446348
MIRT479390	hsa-miR-548v	PAR-CLIP	23446348
MIRT507809	hsa-miR-4463	PAR-CLIP	23446348
MIRT507808	hsa-miR-4436b-3p	PAR-CLIP	23446348
MIRT507807	hsa-miR-4632-5p	PAR-CLIP	23446348
MIRT507806	hsa-miR-6735-5p	PAR-CLIP	23446348
MIRT507805	hsa-miR-6879-5p	PAR-CLIP	23446348
MIRT507804	hsa-miR-7843-5p	PAR-CLIP	23446348
MIRT507802	hsa-miR-4464	PAR-CLIP	23446348
MIRT507803	hsa-miR-4748	PAR-CLIP	23446348
MIRT507801	hsa-miR-329-5p	PAR-CLIP	23446348
MIRT507800	hsa-miR-4667-5p	PAR-CLIP	23446348
MIRT507799	hsa-miR-4700-5p	PAR-CLIP	23446348
MIRT507798	hsa-miR-8089	PAR-CLIP	23446348
MIRT507797	hsa-miR-1267	PAR-CLIP	23446348
MIRT507796	hsa-miR-367-5p	PAR-CLIP	23446348
MIRT507795	hsa-miR-1185-5p	PAR-CLIP	23446348
MIRT507794	hsa-miR-3679-5p	PAR-CLIP	23446348
MIRT507793	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT507792	hsa-miR-3616-3p	PAR-CLIP	23446348
MIRT507791	hsa-miR-3140-3p	PAR-CLIP	23446348
MIRT507790	hsa-miR-5191	PAR-CLIP	23446348
MIRT507789	hsa-miR-34a-5p	PAR-CLIP	23446348
MIRT507788	hsa-miR-34c-5p	PAR-CLIP	23446348
MIRT507787	hsa-miR-449a	PAR-CLIP	23446348
MIRT507786	hsa-miR-449b-5p	PAR-CLIP	23446348
MIRT507785	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT507784	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT507783	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT507782	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT507781	hsa-miR-3175	PAR-CLIP	23446348
MIRT507780	hsa-miR-1343-5p	PAR-CLIP	23446348
MIRT507779	hsa-miR-939-5p	PAR-CLIP	23446348
MIRT507778	hsa-miR-6825-5p	PAR-CLIP	23446348
MIRT507777	hsa-miR-3150a-3p	PAR-CLIP	23446348
MIRT507776	hsa-miR-6763-5p	PAR-CLIP	23446348
MIRT507775	hsa-miR-4743-3p	PAR-CLIP	23446348
MIRT507774	hsa-miR-4652-3p	PAR-CLIP	23446348
MIRT507773	hsa-miR-3147	PAR-CLIP	23446348
MIRT494319	hsa-miR-148b-3p	PAR-CLIP	23592263
MIRT494318	hsa-miR-152-3p	PAR-CLIP	23592263
MIRT053475	hsa-miR-148a-3p	PAR-CLIP	23592263
MIRT494317	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT494316	hsa-miR-4282	PAR-CLIP	23592263
MIRT494315	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT479432	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT479431	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT479430	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT494314	hsa-miR-4255	PAR-CLIP	23592263
MIRT479426	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT494313	hsa-miR-5701	PAR-CLIP	23592263
MIRT494312	hsa-miR-4276	PAR-CLIP	23592263
MIRT494311	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT494310	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT494309	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT494308	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT494307	hsa-miR-335-3p	PAR-CLIP	23592263
MIRT479437	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT479436	hsa-miR-302f	PAR-CLIP	23592263
MIRT479435	hsa-miR-5694	PAR-CLIP	23592263
MIRT479434	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT479433	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT479432	hsa-miR-33b-3p	PAR-CLIP	23592263
MIRT479431	hsa-miR-515-3p	PAR-CLIP	23592263
MIRT479430	hsa-miR-519e-3p	PAR-CLIP	23592263
MIRT479429	hsa-miR-1288-5p	PAR-CLIP	23592263
MIRT479428	hsa-miR-4729	PAR-CLIP	23592263
MIRT479427	hsa-miR-1827	PAR-CLIP	23592263
MIRT479426	hsa-miR-1909-5p	PAR-CLIP	23592263
MIRT479425	hsa-miR-155-5p	PAR-CLIP	23592263
MIRT479424	hsa-miR-6866-5p	PAR-CLIP	23592263
MIRT479422	hsa-miR-5696	PAR-CLIP	23592263
MIRT479423	hsa-miR-153-3p	PAR-CLIP	23592263
MIRT479421	hsa-miR-448	PAR-CLIP	23592263
MIRT479419	hsa-miR-3658	PAR-CLIP	23592263
MIRT479420	hsa-miR-1303	PAR-CLIP	23592263
MIRT479418	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT005065	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT479417	hsa-miR-651-3p	PAR-CLIP	23592263
MIRT479415	hsa-miR-6768-5p	PAR-CLIP	23592263
MIRT479416	hsa-miR-3148	PAR-CLIP	23592263
MIRT479414	hsa-miR-4672	PAR-CLIP	23592263
MIRT479413	hsa-miR-4789-5p	PAR-CLIP	23592263
MIRT000137	hsa-miR-221-3p	PAR-CLIP	23592263
MIRT000131	hsa-miR-222-3p	PAR-CLIP	23592263
MIRT479412	hsa-miR-455-5p	PAR-CLIP	23592263
MIRT479411	hsa-miR-548ac	PAR-CLIP	23592263
MIRT479410	hsa-miR-548bb-3p	PAR-CLIP	23592263
MIRT479409	hsa-miR-548d-3p	PAR-CLIP	23592263
MIRT479408	hsa-miR-548h-3p	PAR-CLIP	23592263
MIRT479407	hsa-miR-548z	PAR-CLIP	23592263
MIRT479406	hsa-miR-548ae-3p	PAR-CLIP	23592263
MIRT479405	hsa-miR-548ah-3p	PAR-CLIP	23592263
MIRT479404	hsa-miR-548aj-3p	PAR-CLIP	23592263
MIRT479403	hsa-miR-548am-3p	PAR-CLIP	23592263
MIRT479402	hsa-miR-548aq-3p	PAR-CLIP	23592263
MIRT479401	hsa-miR-548j-3p	PAR-CLIP	23592263
MIRT479400	hsa-miR-548x-3p	PAR-CLIP	23592263
MIRT479399	hsa-miR-548m	PAR-CLIP	23592263
MIRT479398	hsa-miR-561-3p	PAR-CLIP	23592263
MIRT479397	hsa-miR-548ag	PAR-CLIP	23592263
MIRT479396	hsa-miR-548ai	PAR-CLIP	23592263
MIRT479395	hsa-miR-548ba	PAR-CLIP	23592263
MIRT479394	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT479393	hsa-miR-186-3p	PAR-CLIP	23592263
MIRT479392	hsa-miR-6793-3p	PAR-CLIP	23592263
MIRT479391	hsa-miR-187-5p	PAR-CLIP	23592263
MIRT479390	hsa-miR-548v	PAR-CLIP	23592263
MIRT479389	hsa-miR-2355-5p	PAR-CLIP	23592263
MIRT881709	hsa-miR-103b	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881711	hsa-miR-1185	CLIP-seq
MIRT881712	hsa-miR-1207-3p	CLIP-seq
MIRT881713	hsa-miR-122	CLIP-seq
MIRT881714	hsa-miR-1245	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881718	hsa-miR-153	CLIP-seq
MIRT881719	hsa-miR-155	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT881722	hsa-miR-194	CLIP-seq
MIRT881723	hsa-miR-196a	CLIP-seq
MIRT881724	hsa-miR-196b	CLIP-seq
MIRT881725	hsa-miR-200b	CLIP-seq
MIRT881726	hsa-miR-200c	CLIP-seq
MIRT881727	hsa-miR-221	CLIP-seq
MIRT881728	hsa-miR-222	CLIP-seq
MIRT881729	hsa-miR-223	CLIP-seq
MIRT881730	hsa-miR-24	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT881732	hsa-miR-3065-5p	CLIP-seq
MIRT881733	hsa-miR-3143	CLIP-seq
MIRT881734	hsa-miR-3189-5p	CLIP-seq
MIRT881735	hsa-miR-3200-5p	CLIP-seq
MIRT881736	hsa-miR-323-3p	CLIP-seq
MIRT881737	hsa-miR-330-3p	CLIP-seq
MIRT881738	hsa-miR-34a	CLIP-seq
MIRT881739	hsa-miR-3607-3p	CLIP-seq
MIRT881740	hsa-miR-3613-3p	CLIP-seq
MIRT881741	hsa-miR-3646	CLIP-seq
MIRT881742	hsa-miR-3647-3p	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT881744	hsa-miR-3688-3p	CLIP-seq
MIRT881745	hsa-miR-377	CLIP-seq
MIRT881746	hsa-miR-3921	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT881749	hsa-miR-4254	CLIP-seq
MIRT881750	hsa-miR-4261	CLIP-seq
MIRT881751	hsa-miR-4277	CLIP-seq
MIRT881752	hsa-miR-4284	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT881754	hsa-miR-4310	CLIP-seq
MIRT881755	hsa-miR-4326	CLIP-seq
MIRT881756	hsa-miR-4475	CLIP-seq
MIRT881757	hsa-miR-4490	CLIP-seq
MIRT881758	hsa-miR-4496	CLIP-seq
MIRT881759	hsa-miR-449b	CLIP-seq
MIRT881760	hsa-miR-4503	CLIP-seq
MIRT881761	hsa-miR-452	CLIP-seq
MIRT881762	hsa-miR-4642	CLIP-seq
MIRT881763	hsa-miR-4653-5p	CLIP-seq
MIRT881764	hsa-miR-4663	CLIP-seq
MIRT881765	hsa-miR-4668-5p	CLIP-seq
MIRT881766	hsa-miR-4690-3p	CLIP-seq
MIRT881767	hsa-miR-4718	CLIP-seq
MIRT881768	hsa-miR-4758-3p	CLIP-seq
MIRT881769	hsa-miR-4765	CLIP-seq
MIRT881770	hsa-miR-4766-5p	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881772	hsa-miR-4777-5p	CLIP-seq
MIRT881773	hsa-miR-4795-3p	CLIP-seq
MIRT881774	hsa-miR-4797-3p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT881777	hsa-miR-485-3p	CLIP-seq
MIRT881778	hsa-miR-488	CLIP-seq
MIRT881779	hsa-miR-494	CLIP-seq
MIRT881780	hsa-miR-495	CLIP-seq
MIRT881781	hsa-miR-505	CLIP-seq
MIRT881782	hsa-miR-5096	CLIP-seq
MIRT881783	hsa-miR-519e	CLIP-seq
MIRT881784	hsa-miR-520d-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881787	hsa-miR-524-5p	CLIP-seq
MIRT881788	hsa-miR-539	CLIP-seq
MIRT881789	hsa-miR-548ae	CLIP-seq
MIRT881790	hsa-miR-548aj	CLIP-seq
MIRT881791	hsa-miR-548am	CLIP-seq
MIRT881792	hsa-miR-548c-3p	CLIP-seq
MIRT881793	hsa-miR-548x	CLIP-seq
MIRT881794	hsa-miR-561	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881796	hsa-miR-582-3p	CLIP-seq
MIRT881797	hsa-miR-583	CLIP-seq
MIRT881798	hsa-miR-587	CLIP-seq
MIRT881799	hsa-miR-593	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881801	hsa-miR-619	CLIP-seq
MIRT881802	hsa-miR-626	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT881804	hsa-miR-656	CLIP-seq
MIRT881805	hsa-miR-877	CLIP-seq
MIRT881806	hsa-miR-890	CLIP-seq
MIRT881807	hsa-miR-939	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881713	hsa-miR-122	CLIP-seq
MIRT881714	hsa-miR-1245	CLIP-seq
MIRT1961219	hsa-miR-129-5p	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881718	hsa-miR-153	CLIP-seq
MIRT881719	hsa-miR-155	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT881725	hsa-miR-200b	CLIP-seq
MIRT881726	hsa-miR-200c	CLIP-seq
MIRT881727	hsa-miR-221	CLIP-seq
MIRT881728	hsa-miR-222	CLIP-seq
MIRT881729	hsa-miR-223	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT881733	hsa-miR-3143	CLIP-seq
MIRT1961220	hsa-miR-3171	CLIP-seq
MIRT881734	hsa-miR-3189-5p	CLIP-seq
MIRT881735	hsa-miR-3200-5p	CLIP-seq
MIRT1961221	hsa-miR-3620	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT1961222	hsa-miR-3977	CLIP-seq
MIRT881749	hsa-miR-4254	CLIP-seq
MIRT881751	hsa-miR-4277	CLIP-seq
MIRT1961223	hsa-miR-4290	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT1961224	hsa-miR-4323	CLIP-seq
MIRT881755	hsa-miR-4326	CLIP-seq
MIRT881757	hsa-miR-4490	CLIP-seq
MIRT1961225	hsa-miR-4519	CLIP-seq
MIRT881761	hsa-miR-452	CLIP-seq
MIRT881764	hsa-miR-4663	CLIP-seq
MIRT881766	hsa-miR-4690-3p	CLIP-seq
MIRT1961226	hsa-miR-4694-3p	CLIP-seq
MIRT881768	hsa-miR-4758-3p	CLIP-seq
MIRT881769	hsa-miR-4765	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881772	hsa-miR-4777-5p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT1961227	hsa-miR-502-5p	CLIP-seq
MIRT881784	hsa-miR-520d-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881787	hsa-miR-524-5p	CLIP-seq
MIRT881792	hsa-miR-548c-3p	CLIP-seq
MIRT881794	hsa-miR-561	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881796	hsa-miR-582-3p	CLIP-seq
MIRT881798	hsa-miR-587	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881801	hsa-miR-619	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT881805	hsa-miR-877	CLIP-seq
MIRT881709	hsa-miR-103b	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881712	hsa-miR-1207-3p	CLIP-seq
MIRT2197957	hsa-miR-1261	CLIP-seq
MIRT2197958	hsa-miR-141	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881718	hsa-miR-153	CLIP-seq
MIRT881719	hsa-miR-155	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT2197959	hsa-miR-1914	CLIP-seq
MIRT881722	hsa-miR-194	CLIP-seq
MIRT881723	hsa-miR-196a	CLIP-seq
MIRT881724	hsa-miR-196b	CLIP-seq
MIRT2197960	hsa-miR-199a-5p	CLIP-seq
MIRT2197961	hsa-miR-199b-5p	CLIP-seq
MIRT2197962	hsa-miR-200a	CLIP-seq
MIRT881725	hsa-miR-200b	CLIP-seq
MIRT881726	hsa-miR-200c	CLIP-seq
MIRT2197963	hsa-miR-218	CLIP-seq
MIRT881727	hsa-miR-221	CLIP-seq
MIRT881728	hsa-miR-222	CLIP-seq
MIRT881729	hsa-miR-223	CLIP-seq
MIRT881730	hsa-miR-24	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT2197964	hsa-miR-3074-5p	CLIP-seq
MIRT2197965	hsa-miR-3124-3p	CLIP-seq
MIRT1961220	hsa-miR-3171	CLIP-seq
MIRT881735	hsa-miR-3200-5p	CLIP-seq
MIRT881736	hsa-miR-323-3p	CLIP-seq
MIRT881737	hsa-miR-330-3p	CLIP-seq
MIRT881739	hsa-miR-3607-3p	CLIP-seq
MIRT2197966	hsa-miR-3611	CLIP-seq
MIRT881740	hsa-miR-3613-3p	CLIP-seq
MIRT1961221	hsa-miR-3620	CLIP-seq
MIRT2197967	hsa-miR-3667-3p	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT2197968	hsa-miR-3691-5p	CLIP-seq
MIRT881745	hsa-miR-377	CLIP-seq
MIRT881746	hsa-miR-3921	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT1961222	hsa-miR-3977	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT881751	hsa-miR-4277	CLIP-seq
MIRT881752	hsa-miR-4284	CLIP-seq
MIRT1961223	hsa-miR-4290	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT881754	hsa-miR-4310	CLIP-seq
MIRT1961224	hsa-miR-4323	CLIP-seq
MIRT881755	hsa-miR-4326	CLIP-seq
MIRT881756	hsa-miR-4475	CLIP-seq
MIRT881760	hsa-miR-4503	CLIP-seq
MIRT1961225	hsa-miR-4519	CLIP-seq
MIRT881761	hsa-miR-452	CLIP-seq
MIRT881762	hsa-miR-4642	CLIP-seq
MIRT881763	hsa-miR-4653-5p	CLIP-seq
MIRT2197969	hsa-miR-4662a-5p	CLIP-seq
MIRT2197970	hsa-miR-4670-3p	CLIP-seq
MIRT2197971	hsa-miR-4676-5p	CLIP-seq
MIRT2197972	hsa-miR-4684-5p	CLIP-seq
MIRT881766	hsa-miR-4690-3p	CLIP-seq
MIRT1961226	hsa-miR-4694-3p	CLIP-seq
MIRT881767	hsa-miR-4718	CLIP-seq
MIRT2197973	hsa-miR-4752	CLIP-seq
MIRT881768	hsa-miR-4758-3p	CLIP-seq
MIRT881770	hsa-miR-4766-5p	CLIP-seq
MIRT2197974	hsa-miR-4768-5p	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881773	hsa-miR-4795-3p	CLIP-seq
MIRT881774	hsa-miR-4797-3p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT881777	hsa-miR-485-3p	CLIP-seq
MIRT881778	hsa-miR-488	CLIP-seq
MIRT1961227	hsa-miR-502-5p	CLIP-seq
MIRT881782	hsa-miR-5096	CLIP-seq
MIRT881783	hsa-miR-519e	CLIP-seq
MIRT881784	hsa-miR-520d-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881787	hsa-miR-524-5p	CLIP-seq
MIRT881789	hsa-miR-548ae	CLIP-seq
MIRT881790	hsa-miR-548aj	CLIP-seq
MIRT881791	hsa-miR-548am	CLIP-seq
MIRT881793	hsa-miR-548x	CLIP-seq
MIRT2197975	hsa-miR-579	CLIP-seq
MIRT881798	hsa-miR-587	CLIP-seq
MIRT881799	hsa-miR-593	CLIP-seq
MIRT2197976	hsa-miR-595	CLIP-seq
MIRT2197977	hsa-miR-600	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881802	hsa-miR-626	CLIP-seq
MIRT2197978	hsa-miR-636	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT2197979	hsa-miR-648	CLIP-seq
MIRT881804	hsa-miR-656	CLIP-seq
MIRT881805	hsa-miR-877	CLIP-seq
MIRT881806	hsa-miR-890	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT881729	hsa-miR-223	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT1961220	hsa-miR-3171	CLIP-seq
MIRT1961221	hsa-miR-3620	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT1961222	hsa-miR-3977	CLIP-seq
MIRT881751	hsa-miR-4277	CLIP-seq
MIRT1961223	hsa-miR-4290	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT1961224	hsa-miR-4323	CLIP-seq
MIRT881755	hsa-miR-4326	CLIP-seq
MIRT881766	hsa-miR-4690-3p	CLIP-seq
MIRT881768	hsa-miR-4758-3p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881710	hsa-miR-105	CLIP-seq
MIRT881715	hsa-miR-148a	CLIP-seq
MIRT881716	hsa-miR-148b	CLIP-seq
MIRT881717	hsa-miR-152	CLIP-seq
MIRT881720	hsa-miR-190	CLIP-seq
MIRT881721	hsa-miR-190b	CLIP-seq
MIRT881730	hsa-miR-24	CLIP-seq
MIRT881731	hsa-miR-2964a-5p	CLIP-seq
MIRT881740	hsa-miR-3613-3p	CLIP-seq
MIRT881743	hsa-miR-3671	CLIP-seq
MIRT881747	hsa-miR-3924	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT881752	hsa-miR-4284	CLIP-seq
MIRT881753	hsa-miR-4302	CLIP-seq
MIRT881760	hsa-miR-4503	CLIP-seq
MIRT881771	hsa-miR-4775	CLIP-seq
MIRT881774	hsa-miR-4797-3p	CLIP-seq
MIRT881775	hsa-miR-4797-5p	CLIP-seq
MIRT881784	hsa-miR-520d-5p	CLIP-seq
MIRT881785	hsa-miR-520f	CLIP-seq
MIRT881786	hsa-miR-522	CLIP-seq
MIRT881787	hsa-miR-524-5p	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881798	hsa-miR-587	CLIP-seq
MIRT881800	hsa-miR-607	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT881806	hsa-miR-890	CLIP-seq
MIRT2197963	hsa-miR-218	CLIP-seq
MIRT881761	hsa-miR-452	CLIP-seq
MIRT2197976	hsa-miR-595	CLIP-seq
MIRT2197978	hsa-miR-636	CLIP-seq
MIRT2197979	hsa-miR-648	CLIP-seq
MIRT2501224	hsa-miR-3136-5p	CLIP-seq
MIRT881733	hsa-miR-3143	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT2501225	hsa-miR-4439	CLIP-seq
MIRT881772	hsa-miR-4777-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT881792	hsa-miR-548c-3p	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq
MIRT2501226	hsa-miR-943	CLIP-seq
MIRT2501227	hsa-miR-944	CLIP-seq
MIRT881733	hsa-miR-3143	CLIP-seq
MIRT881748	hsa-miR-4252	CLIP-seq
MIRT881772	hsa-miR-4777-5p	CLIP-seq
MIRT881776	hsa-miR-4803	CLIP-seq
MIRT881792	hsa-miR-548c-3p	CLIP-seq
MIRT881795	hsa-miR-568	CLIP-seq
MIRT881803	hsa-miR-643	CLIP-seq

Show/Hide all (28)

Transcription factor	Regulation	Reference
BRCA1	Activation	18025037
BRCA1	Unknown	16331276
COPS5	Repression	16951171
CUX1	Unknown	19332113
ESR1	Repression	17681750
FHL2	Activation	21377781
FOXO1	Activation	21418583
HOXB7	Repression	21474578
ING4	Activation	20707719
ING4	Unknown	18399550
IRF9	Activation	15362048
KAT2B	Activation	19525977
KLF4	Activation	22170594
MEN1	Activation	10523037
MYCN	Unknown	16618721
NFYA	Activation	15064717
NFYB	Activation	15064717
NFYC	Activation	15064717
NR4A1	Activation	12842839
PROX1	Activation	17069925
SP1	Activation	12907235;15064717;16518840
SP1	Unknown	10542271;15951157;22415074
STAT3	Unknown	18320073
TP53	Unknown	15988033
UTF1	Unknown	23536577
VDR	Activation	16518840
VHL	Activation	10778984
ZNF300	Repression	21777376

Show/Hide all (87)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	8033212
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS
GO:0001890	Process	Placenta development	IEA
GO:0004860	Function	Protein kinase inhibitor activity	IEA
GO:0004860	Function	Protein kinase inhibitor activity	IMP	8684460
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IBA
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IDA	8033212, 10918569, 28666995
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA
GO:0004861	Function	Cyclin-dependent protein serine/threonine kinase inhibitor activity	TAS	10208428
GO:0005515	Function	Protein binding	IPI	8684460, 8756624, 9106657, 9840943, 11961546, 12082530, 12093740, 15024385, 15057270, 15480426, 15652749, 15890360, 16189514, 16209941, 16289477, 16326706, 16431923, 17053782, 17254966, 17254967, 17418410, 17698606, 18177895, 18593906, 18692475, 18805092, 19470470, 20596027, 2142321
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11800646, 12093740
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12093740
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005929	Component	Cilium	IDA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007096	Process	Regulation of exit from mitosis	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS	24380855
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	19838216
GO:0012501	Process	Programmed cell death	IEA
GO:0019901	Function	Protein kinase binding	IPI	15024385
GO:0019903	Function	Protein phosphatase binding	IPI	19838216
GO:0019914	Function	Cyclin-dependent protein kinase regulator activity	EXP	8684460
GO:0030308	Process	Negative regulation of cell growth	IDA	10208428
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	TAS
GO:0030332	Function	Cyclin binding	IEA
GO:0030332	Function	Cyclin binding	IPI	15024385
GO:0030332	Function	Cyclin binding	ISS	24380855
GO:0030334	Process	Regulation of cell migration	IEA
GO:0031116	Process	Positive regulation of microtubule polymerization	IEA
GO:0031464	Component	Cul4A-RING E3 ubiquitin ligase complex	IDA	21628527
GO:0031625	Function	Ubiquitin protein ligase binding	EXP	16209941
GO:0033673	Process	Negative regulation of kinase activity	IDA	19170105
GO:0036064	Component	Ciliary basal body	IDA
GO:0044877	Function	Protein-containing complex binding	IPI	8684460, 15024385
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	19056892
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	28666995
GO:0045740	Process	Positive regulation of DNA replication	TAS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	19170105
GO:0045926	Process	Negative regulation of growth	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IBA
GO:0048102	Process	Autophagic cell death	IDA	12698196
GO:0048839	Process	Inner ear development	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IBA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051168	Process	Nuclear export	IMP	12529437
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	12093740
GO:0051726	Process	Regulation of cell cycle	ISS	24380855
GO:0060090	Function	Molecular adaptor activity	EXP	8684460
GO:0060767	Process	Epithelial cell proliferation involved in prostate gland development	IEA
GO:0060770	Process	Negative regulation of epithelial cell proliferation involved in prostate gland development	IEA
GO:0071236	Process	Cellular response to antibiotic	IEA
GO:0071285	Process	Cellular response to lithium ion	IDA	19056892
GO:0090398	Process	Cellular senescence	TAS
GO:0140678	Function	Molecular function inhibitor activity	IMP	11790096
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	IEA
GO:1902746	Process	Regulation of lens fiber cell differentiation	IEA
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	IMP	8033212
GO:1904019	Process	Epithelial cell apoptotic process	IEA
GO:1904030	Process	Negative regulation of cyclin-dependent protein kinase activity	IMP	8684460
GO:1904036	Process	Negative regulation of epithelial cell apoptotic process	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IMP	19088079
GO:1905179	Process	Negative regulation of cardiac muscle tissue regeneration	IEA
GO:1905179	Process	Negative regulation of cardiac muscle tissue regeneration	ISS	24380855
GO:1990757	Function	Ubiquitin ligase activator activity	EXP	16209941
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IDA	10208428

MIM	HGNC	e!Ensembl
600778	1785	ENSG00000111276

P46527

Protein name

Cyclin-dependent kinase inhibitor 1B (Cyclin-dependent kinase inhibitor p27) (p27Kip1)

Protein function

Important regulator of cell cycle progression. Inhibits the kinase activity of CDK2 bound to cyclin A, but has little inhibitory activity on CDK2 bound to SPDYA (PubMed:28666995). Involved in G1 arrest. Potent inhibitor of cyclin E- and cyclin A

PDB

1H27 , 1JSU , 2AST , 5UQ3 , 6ATH , 6P8E , 6P8F , 6P8G , 7B5L , 7B5M , 7B5R , 7OR8 , 7ORG , 7ORH , 7ORS , 7ORT , 8BYA , 8BYL , 8BZO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02234	CDI	31 → 79	Cyclin-dependent kinase inhibitor	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in kidney (at protein level) (PubMed:15509543). Expressed in all tissues tested (PubMed:8033212). Highest levels in skeletal muscle, lowest in liver and kidney (PubMed:8033212). {ECO:0000269|PubMed:15509543, ECO:0000269|PubMe

Sequence

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT

Sequence length

198

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
CDKN1B-related disorder	Pathogenic	rs1946491661	RCV003410348	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary cancer-predisposing syndrome	Pathogenic; Likely pathogenic	rs1292160956, rs1946498768, rs1202861028, rs1328655695, rs2136355372, rs2136356377, rs797044482, rs2136356126, rs2497405244, rs786201011, rs2497404197, rs2136355715, rs2497404448, rs2497404536, rs2497405447 View all (18 more)	RCV002334840 RCV002331497 RCV002334968 RCV002324404 RCV002425256 View all (29 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Lung cancer	Pathogenic	rs1946487230	RCV005912473	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Multiple endocrine neoplasia type 4	Pathogenic; Likely pathogenic	rs1292160956, rs2136355351, rs2136355500, rs2136355706, rs2136355743, rs2136355975, rs2136356368, rs1946498768, rs2136355920, rs1202861028, rs1328655695, rs2136355372, rs2136355734, rs2136356377, rs2136355842 View all (42 more)	RCV001922605 RCV001385780 RCV001381151 RCV001389331 RCV001380515 View all (55 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neoplasm	Pathogenic	rs1328655695	RCV006274286	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neuroendocrine neoplasm	Likely pathogenic; Pathogenic	rs797044481, rs797044482, rs797044483	RCV000191951 RCV000191952 RCV000191953	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (32)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHLORACNE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial hyperparathyroidism or Hypocalciuric hypercalcaemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary nonpolyposis colon cancer	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar ClinGen, GenCC	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPERPARATHYROIDISM, PRIMARY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple endocrine neoplasia	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple endocrine neoplasia, type 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary hyperparathyroidism	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC INTRAEPITHELIAL NEOPLASIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEZARY SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (510)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acoustic Neuroma	Acoustic Neuroma	LHGDN	16283443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	20530095, 21778740, 25645465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	22291433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19963112, 7579355, 8605354, 8640833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	15936816, 22072540, 25213837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10697493, 24095829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11499840, 12047142, 12670508, 15014027, 18172308, 20059402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12085261, 14614018, 14707458, 15014027, 18415709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11557114, 12356584, 21285982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	16951171, 25053516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	12210483, 18415709, 9458103, 9578081, 9927492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19318494, 26695862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	19522821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	17525487, 17554557, 18317952, 19522821, 19876893, 23933118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19963112, 7579355, 8640833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	11522621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	14500378, 19147535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11042529, 16601696, 7655021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	27084744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10603039, 15583032, 18415709, 23324130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	LHGDN	12133571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	15029207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	27084744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15061869, 17351341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21676922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22183962	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23944957, 30075531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11355304, 15925990, 18345413, 8621784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15367334, 18345413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11457838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15061869, 17351341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15061869, 17351341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10397744, 10597239, 12351407, 17502456, 27153225		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10727987, 19187271, 21478095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	9731735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	35439345	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	11844064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	15596046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	15596046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10955794, 16413663, 19955487, 9864434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18334837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	24098519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26908328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	8621784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10481943, 11118465, 11455031, 12015771, 12082635, 12244303, 12611462, 12782606, 12907598, 14512390, 14654548, 14871808, 15082918, 15627896, 15802279 View all (41 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17092400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10188908, 10757805, 10908655, 12123335, 12700233, 12904306, 15627896, 15665120, 15802279, 15996662, 16168119, 16208702, 16216245, 17148774, 17690504 View all (18 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	22199306	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	12123335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	10597239, 17464290, 31000522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	15665120, 9212741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15743786, 17008550, 17722244, 21289244, 21454826, 22291433, 23029392, 23155381, 23351380, 23725357, 29397868, 33316141, 35926659, 7655021, 9250163, 9466585 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	29017393, 37954063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid tumor of lung	Carcinoid Tumor Of Lung	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10078919, 10397272, 10534337, 10597239, 10603039, 10623664, 11042700, 14984940, 16007165, 19276161, 19855998, 20334896, 23409082, 9731735, 9891436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	22199306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15133847, 15298730, 15457552, 15777850, 16014626, 16052694, 18781093, 18808421, 28713927, 29397868, 30473536, 33960941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	21683992	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10955794, 19955487, 9864434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Endocrine Gland	Endocrine Gland cancer	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10435640, 11165393, 11474135, 19648963, 25143434, 25851349, 26430715, 26567140, 27880728, 9673367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	12123335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17409409, 9916926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21262926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11920465, 18922157, 20339477, 20626751, 32229735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15743689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	10514396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	LHGDN	18203777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10329035, 10446997, 20461750, 23277402, 23907459, 24018641, 25926381, 26198169, 26213845, 26320455, 27314502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	18194512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	18194512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney Complex	BEFREE	21778740, 22144223, 25592387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Triad	Carney Triad	BEFREE	19522821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	36806942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	15061869		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15710386, 24423924		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15710386, 24423924, 9648593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10935480, 19963112, 7579355, 8640833, 8653712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	14500378, 19147535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19414361, 19528460, 25663461, 28882106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24574749, 25663461, 28882106, 35926659, 40682835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	15664414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18288099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10727987, 12040434, 12351407, 16053658, 17981326, 19187271, 21478095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30075531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21224344, 24885920, 9926925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32232325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal cancer, hereditary nonpolyposis, type 1	Colorectal Cancer	CLINGEN_DG	12086850, 15584024, 17631145, 17954563, 25058500, 9736017, 9823898, 9926925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11802199, 12244568, 15073847, 15722793, 17086168, 17239930, 18855981, 20673328, 22490519, 24151081, 24346863, 26114183, 29069290, 9018245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12467060, 15073847, 15717322, 16369045, 17072952, 17086168, 17239930, 18320073, 19276255, 19290007, 19505918, 19686745, 20673328, 21639915, 22970236 View all (9 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12508646, 15722793, 17123889, 17239930, 19082479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	11844064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11920465, 17310312, 17851288, 19246164, 21981759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23312942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	36180886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	23312942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28286054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	35323929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	23505216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20083846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20083846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25409512	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27380896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30984546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25409512, 27380896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	29115286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37745718, 40312440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	29115286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	9466585	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11522621, 12107101, 12351407, 12940773, 17573669, 18850583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	LHGDN	12531224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	27121343		★★★★★ ★☆☆☆☆ Found in Text Mining only
dopamine beta hydroxylase deficiency		Pubtator	22199306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	10757805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	24806449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	22199306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	22199306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	9466585	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine Gland Neoplasms	Endocrine Gland Neoplasms	BEFREE	26184857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11389092, 12405911, 16809439, 21454826, 23029392, 24035998, 26963853, 29509243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20565904	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21454826, 22114462, 23029392, 28040131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11334908, 19855998, 20546339, 25534318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	11334908, 18321488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	18321488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10446997, 24018641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	14606065, 16425348, 23301842, 24402707, 31218209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	14606065, 23301842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16425348, 24402707, 31218209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27292876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24574749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fallopian Tube Carcinoma	Fallopian Tube Carcinoma	BEFREE	17927588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial benign hypercalcemia	Hypocalciuric hypercalcemia	BEFREE	26163537, 28874394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Isolated Hyperparathyroidism	Hyperparathyroidism	BEFREE	23652676, 29036195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	21177330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	18756055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	22322669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	17927588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	17384652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	18474118, 31553483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	19522821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	23009113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	27121343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10603039, 10958682, 15557280, 15605273, 16554441, 17721077, 22217655, 22337773, 22650359, 23339869, 23448150, 26663363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	12133571, 17721077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15517868, 15542603, 17721077, 22217655, 27142352, 28381184, 35550147, 36792756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10958682, 15557280, 15605273, 16554441, 17721077, 22217655, 22337773, 22650359, 23339869, 23448150, 26663363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10737594, 19424584, 23022473, 24018641, 25362936, 26088461, 30231237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10737594, 12698196, 17565690, 25399650, 26535026, 28582703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12133571, 12698196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	23505216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	15208647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	14694160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucagonoma	Glucagonoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	30018638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	11598173, 26065650, 26294716, 28297625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	12890807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12586749, 16077910, 30642385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10036184, 15475071, 21422114, 28797197, 8547659, 8640833, 8978784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	LHGDN	15475071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	7632960, 8547659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	7632960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	11957145, 18568767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	LHGDN	11957145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	CTD_human_DG	17620307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30394935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15138205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	12940773, 24178620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Non-Polyposis Colon Cancer Type 2	Colorectal Cancer	CLINGEN_DG	12086850, 15584024, 17631145, 17954563, 25058500, 9736017, 9823898, 9926925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary non-polyposis colorectal cancer syndrome	Hereditary nonpolyposis colorectal cancer	CLINGEN_DG	12086850, 15584024, 17631145, 17954563, 25058500, 9736017, 9823898, 9926925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	CLINGEN_DG	12086850, 15584024, 17631145, 17954563, 25058500, 9736017, 9823898, 9926925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	CLINGEN_DG	12086850, 15584024, 17631145, 17954563, 25058500, 9736017, 9823898, 9926925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	15026335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10727987, 12153002, 18285702, 7655021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	15389259, 28432871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22426400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	15213602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	18288099, 22129891, 24819502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	Pubtator	18288099, 36334246, 37810884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Primary	Hyperparathyroidism	Pubtator	35323929, 36334246, 37810884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	19474519, 27038812, 27306766, 28824003, 30641515		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperparathyroidism, Primary	Hyperparathyroidism	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperparathyroidism, Secondary	Hyperparathyroidism	LHGDN	12771291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	15009006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism-Jaw Tumor Syndrome	Hyperparathyroidism-Jaw Tumor Syndrome	BEFREE	26163537, 27306766, 28674121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	15061869, 17710155, 9033255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	23505216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35439345	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	Pubtator	37876543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocalciuric hypercalcemia, familial, type 1	Hypocalciuric Hypercalcemia	BEFREE	28874394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24860972	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	14694160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	15060836		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30984546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	30984546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30984546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	CTD_human_DG	24185511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	CTD_human_DG	24185511		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	23242522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10914556, 10918213, 27708228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	11480564, 11494142, 12153002, 12531224, 12631617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	15374880, 16194892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	21693435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	15357873	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyoma	Leiomyoma	Pubtator	31159158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10036184, 15746092, 15833859, 16019539, 21593192, 24860972, 30065619, 7882309, 7882310, 8653712, 9209394, 9370275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11035070, 19657571, 21418583, 22142798, 35738638, 39519258, 39950487, 9746784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12133429, 15833859, 16019539, 16526056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	26065650, 26294716, 28801450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	15746092, 19221487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	14525786, 15289327, 21084834, 21422114, 25213837, 26053097, 28522571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10090931, 16195327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	12940773, 24178620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15289327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15936816, 18987662, 21422114, 22072540, 25213837, 31171000, 9171997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11042529, 16601696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	LHGDN	12820381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	12167427, 12684618, 15645112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	10920137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10397455, 10398686, 10779646, 11521219, 12244568, 12482975, 15082532, 15457552, 16052694, 16112786, 18357344, 18521080, 18808421, 19533683, 19671867 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15133847, 15161709, 15777850, 17974156, 18346358, 18350604		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	20698225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16052694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	16052694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10398686, 12244568, 15457552, 16112786		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	16391232		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	BEFREE	12351407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	12466968, 16391232, 20512841		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	16966613		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	22848476, 25851349, 27802291, 30375484, 36224313	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	9500468		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17608810, 33982894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	23273568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	23273568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15743689, 17685465, 22114462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10424746, 12780788, 9212741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10983687	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11494142, 12107101, 12351407, 16019539, 17464290, 17626791, 18285702, 19147568, 9209394, 9370275, 9680343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12351407, 14666612, 16019539, 16194892, 18095123, 18285702, 18363870, 18514141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12351407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	18363870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17502456, 18363870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	17502456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	18363870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	23893766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	15029207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	11848481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12586749, 16077910, 30642385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	10627471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	17502456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10481943, 11118465, 12082635, 12123335, 12244303, 12782606, 12907598, 14512390, 14654548, 14871808, 15082918, 15627896, 15802279, 15930334, 16035731 View all (39 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17092400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16809439, 21454826, 23029392, 24035998, 26963853, 29509243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24402707, 31218209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	10504547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	15357873, 17310312, 29515762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	21693435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	16391232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25572801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10435640, 11165393, 11474135, 19648963, 25143434, 25851349, 26430715, 26567140, 27880728, 9500468, 9673367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	12466968, 16391232, 20512841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	12167427, 12684618, 15172637, 15645112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	16391232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20461750, 23277402, 25926381, 26198169, 26213845, 26320455, 27314502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15572689, 15930308, 17960560, 18559508, 19639215, 23393547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10397272, 10576664, 10827191, 10840458, 12188931, 12210483, 12727815, 15026335, 15185141, 15545300, 15701964, 16267836, 16425184, 17319789, 18645269 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	12727815, 20932324, 29610475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10705239, 20059402, 20668328, 22343731, 27086911, 27572672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15138205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20075119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10397272, 10955794, 15082203, 19955487, 9864434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10383715, 10576664, 10597239, 10699962, 10705239, 10779229, 10783304, 11042700, 11237531, 11474135, 12167427, 12244303, 12351407, 12417796, 12548012 View all (67 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	15715079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15710386, 24423924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10397272, 21224344, 24885920, 9926925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17092400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12244302, 12244303, 12904306, 14654548, 15592362, 15996662, 16035731, 16636894, 16804901, 17148774, 17567920, 17804714, 18037997, 18708351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17092400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19360356, 24457952, 25744729, 27035903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17092400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	10627471, 11598173, 12351407, 12515730, 12940773, 17502456, 24178620, 26022239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	11598173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	21177330, 23933118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	14500378, 19147535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10594749, 10944199, 11415463, 21336261, 22970236, 28231799, 28762556, 9665492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11042700, 11602203, 15205952, 15735667, 16916716, 16924241, 19126397, 9416843		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	15154004, 15492811, 15736055, 17553787, 18027257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	24583340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	26762354	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	18301454		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	7882310		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	11536304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	10585280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	15936816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	10711250	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	12684618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	9466585	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	12047142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	19531414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11598173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	17030811, 17097557, 17519308, 17554557, 17710155, 18317952, 18710468, 19522821, 20530095, 20541671, 20833334, 20937862, 20980721, 23505216, 23555276 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	LHGDN	17519308		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	GENOMICS_ENGLAND_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	17299066, 17519308, 18288099, 18710468, 19318494, 19407509, 19522821, 20616437, 20829611, 20980721, 21289244, 21441703, 21627674, 22026581, 23933118 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	ORPHANET_DG	22026581, 25824098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia type 1	Multiple Endocrine Neoplasia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2b	Multiple Endocrine Neoplasia	BEFREE	24931355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia type 4	Multiple Endocrine Neoplasia	CLINGEN_DG	17030811, 17519308, 18354415, 19141585, 20824794, 22129891, 23555276, 24819502, 8646779		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multiple endocrine neoplasia type 4	Multiple Endocrine Neoplasia	BEFREE	20530095, 26762354, 31658440		★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multiple endocrine neoplasia type 4	Multiple Endocrine Neoplasia	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multiple Endocrine Neoplasia, Type IV	Multiple Endocrine Neoplasia	CLINGEN_DG	17030811, 17519308, 18354415, 19141585, 20824794, 22129891, 23555276, 24819502, 8646779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia, Type IV	Multiple Endocrine Neoplasia	BEFREE	20530095, 20541671, 22129891, 23555276, 23652671, 23800691, 24819502, 24920291, 31658440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia, Type IV	Multiple Endocrine Neoplasia	GENOMICS_ENGLAND_DG	25162666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia, Type IV	Multiple Endocrine Neoplasia	ORPHANET_DG	25416039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia, Type IV	Multiple Endocrine Neoplasia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia, Type IV	Multiple Endocrine Neoplasia	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11278272	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12576455, 16188652, 20930946, 23479461, 23893766, 31666930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12576455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16188652, 17303695, 22142798, 27319807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15936816, 9171997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12456669, 15833859, 16952195, 24098519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15061869, 17351341, 31485654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	15061869, 17351341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	12707036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24359578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30950204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	19735566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10096572, 10397272, 10446997, 10458687, 10480372, 10534337, 10576664, 10580149, 10597239, 10623664, 10699962, 10728913, 10918213, 10955794, 11042700 View all (191 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11307151, 14691455, 15390183, 16007177, 16928812, 22508481, 23440295, 25960164, 28667701, 8630967, 9681834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15390183, 23440295, 25264277, 28246384, 28667701, 31863533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental disorder	Pubtator	23505216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	19010853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	23652671, 24185511, 25586243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	CTD_human_DG	24185511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	15715079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	15715079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	30990521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10598929, 11141482, 11267976, 11557117, 16988944, 17133272, 17456787, 20047843, 21706050, 22925699, 23584484, 24041868, 25143434, 27880728, 29137415, 8631006, 9270000, 9500468, 9973218 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	17316413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	17316413		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	10603039, 20062078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	11419973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	15061869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15583032, 16314512, 22158041, 30992462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	15583032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22158041, 30992462, 33960434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	20461750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	20615757, 21575944		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10329035, 11751512, 23277402, 25926381, 26198169, 26213845, 26320455, 27314502		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15924242		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	16391232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12853350, 15075339, 17409409, 25926381, 26213845, 26320455, 28122348, 30769778, 33801209, 35941978, 9155043, 9916926	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17409409	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11034103, 15572689, 15930308, 17960560, 18559508, 19639215, 23393547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	23555276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Endocrine Carcinoma	Pancreatic Endocrine Carcinoma	BEFREE	21441703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16086840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21177330, 23555276, 25677816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16086840, 16951171, 18980972, 19910837, 21909380, 23393547, 23555276, 25027401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22293850	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17685465, 23203004, 24643689, 26762354, 27314298, 27834461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	17554557, 19522821, 23242522, 23778871		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARAGANGLIOMA AND GASTRIC STROMAL SARCOMA	Paraganglioma and gastric stromal sarcoma	BEFREE	19522821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	21289244, 21985978, 23715670, 27038812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid hyperplasia	Parathyroid hyperplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	17030811, 18288099, 20616437, 23715670, 23933118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	21289244, 23715670, 26762354, 33316141, 38244045, 9033255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31499060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Peptic Ulcer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	21045237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	17525487, 17554557, 18317952, 19522821, 19876893, 23933118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	CTD_human_DG	16391232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	GENOMICS_ENGLAND_DG	17030811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	20507346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma Familial Isolated	Pituitary adenoma	Pubtator	22291433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PITUITARY ADENOMA, FAMILIAL ISOLATED (disorder)	Pituitary adenoma	BEFREE	20530095, 22291433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary carcinoma	Pituitary carcinoma	CTD_human_DG	16391232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	27824399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary growth hormone cell adenoma	Pituitary adenoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	14558671		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Neoplasms	Pituitary Neoplasms	CTD_human_DG	16391232		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	22291433, 23555276, 25494863, 35323929, 9250163, 9365157	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	24532476		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30293818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32729067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	17008550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17008550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	8605354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	15475071, 17560996, 28482719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	20615757, 21575944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	24741631, 30253330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	11522621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	9328342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	19318494, 21441703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	15026335, 15185141, 16267836		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10576664, 10827191, 10840458, 11536304, 12210483, 12727815, 15026335, 15185141, 15545300, 15701964, 16267836, 16425184, 17319789, 17569667, 18645269 View all (13 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	15314639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	9736039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	18691549, 9458103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	LHGDN	18691549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	CTD_human_DG	20932324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10576664, 15798096, 16097446, 17522055, 18415709, 18687691, 20053773, 21182779, 21932423, 26636522, 27268646, 28212547, 29892016, 31969336, 32763409, 35430569, 36360276, 37239316, 9927492 View all (4 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10827191, 11175773, 19266349, 9815624		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12188931, 12429629, 12727815, 15026335, 15798096, 16097446, 17319789, 17404436, 18583941, 18645269, 18691549		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	12727815, 20932324, 29610475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pterygium	Pterygium	BEFREE	25053875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	11352304, 18334831, 28326100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	CTD_human_DG	15525823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	CTD_human_DG	15525823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	15357873, 17310312, 29515762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11920465, 17310312, 17851288, 19246164, 26944622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	11920465, 17404431, 17851288, 18425369, 18922157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10680599, 12040434, 15583032, 15666088, 15746092, 16012758, 17148439, 17456787, 17951406, 18537129, 20175458, 21403466, 24987858, 27821477, 31638183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	LHGDN	16012758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	19843869	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	26730174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	20212451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	12359053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24812285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	12824885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	12824885	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15652749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	18271016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	23009113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	CTD_human_DG	26551667		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sezary Syndrome	Sezary syndrome	Pubtator	26551667	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin lesion	Skin Lesion	BEFREE	10918213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10074929, 16410797, 26008974, 9864434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	26008974, 9421477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Intestinal Neuroendocrine Neoplasm	Small Intestinal Neuroendocrine Neoplasm	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	12351407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotrophinoma, Familial	Somatotroph adenoma	BEFREE	22144223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11585732, 12670508, 15172637, 18620845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12527941, 12599217, 12670508, 14707456, 15217930, 15645120, 17203174, 18203777, 18695910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15161026, 24402707, 27292876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16619581, 16740156, 17217620, 20805359, 28338203, 33664437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29616113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	12478543, 30250532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10705239, 20059402, 20668328, 22343731, 27086911, 27572672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10948161, 12149143, 17483253, 17722244, 21439087, 26470770, 27099442, 9310133, 9741540	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12239454		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15138205		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	15061869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subcutaneous lipoma	Subcutaneous lipoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	11251953		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	18073348		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	LHGDN	18073348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	17685465, 19461157, 26762354, 27314298, 31298336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10918569, 17914108, 20075119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	GENOMICS_ENGLAND_DG	17030811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	25576899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
THYROID CARCINOMA, SPORADIC MEDULLARY	Thyroid Carcinoma	BEFREE	21177330, 25565272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17188136, 18766473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20075119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	15743786, 25576899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25132260, 27694903, 31033460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31033460, 33227964, 34326372, 35504904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	17927973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25536625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	CTD_human_DG	16391232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	16474380	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	12051885, 17581405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	9891436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	10711250, 15710386	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24423924, 35439960, 38112461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	CTD_human_DG	16391232		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	BEFREE	22653968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22653968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19667240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	23312942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	15526363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	10603039, 20062078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	14760081, 21594709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group C	Xeroderma pigmentosum	Pubtator	12485438	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	26213845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Zollinger-Ellison syndrome	Zollinger-Ellison syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

CDKN1B (cyclin dependent kinase inhibitor 1B)