CDKL3 (cyclin dependent kinase like 3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 51265
• Gene name: Cyclin dependent kinase like 3
• Gene symbol: CDKL3
• Synonyms (NCBI Gene): NKIAMRE
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: The protein encoded by this gene is a member of cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important r

miRNA Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT881615	hsa-miR-1253	CLIP-seq
MIRT881616	hsa-miR-143	CLIP-seq
MIRT881617	hsa-miR-2682	CLIP-seq
MIRT881618	hsa-miR-3919	CLIP-seq
MIRT881619	hsa-miR-449c	CLIP-seq
MIRT881620	hsa-miR-4770	CLIP-seq
MIRT881621	hsa-miR-940	CLIP-seq
MIRT2197951	hsa-miR-3117-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	10463609
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 31515488, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030517	Process	Negative regulation of axon extension	IBA
GO:0030517	Process	Negative regulation of axon extension	IEA
GO:0036211	Process	Protein modification process	TAS	10463609
GO:0050775	Process	Positive regulation of dendrite morphogenesis	IBA
GO:0050775	Process	Positive regulation of dendrite morphogenesis	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0097484	Process	Dendrite extension	IBA
GO:0097484	Process	Dendrite extension	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 608459
• HGNC: 15483
• e!Ensembl: ENSG00000006837

Protein

• UniProt ID: Q8IVW4
• Protein name: Cyclin-dependent kinase-like 3 (EC 2.7.11.22) (Serine/threonine-protein kinase NKIAMRE)
• PDB: 3ZDU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	4 → 286	Protein kinase domain	Domain

• Sequence:

  MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHE
  NLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNN
  IIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGK
  PVDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLP
  QVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSDLLHHEYFTRDGFIEKFMPELK
  AKLLQEAKVNSLIKPKESSKENELRKDERKTVYTNTLLSSSVLGKEIEKEKKPKEIKVRV
  IKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINPSTNCNGLKE
  NPHCGGSVTMPPINLTNSNLMAANLSSNLFHPSVRLTERAKKRRTSSQSIGQVMPNSRQE
  DPGPIQSQMEKGIFNERTGHSDQMANENKRKLNFSRSDRKEFHFPELPVTIQSKDTKGME
  VKQIKMLKRESKKTESSKIPTLLNVDQNQEKQEGGDGHCEGKNLKRNRFFFW

• Sequence length: 592

Related Genes

No strongly related genes found yet for CDKL3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CDKL3.