CDK7 (cyclin dependent kinase 7)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1022
• Gene name: Cyclin dependent kinase 7
• Gene symbol: CDK7
• Synonyms (NCBI Gene): CAK, CAK1, CDKN7, HCAK, MO15, STK1, p39MO15
• Chromosome: 5
• Chromosome location: 5q13.2
• Summary: The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be importa

miRNA Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027787	hsa-miR-98-5p	Microarray	19088304
MIRT042517	hsa-miR-423-3p	CLASH	23622248
MIRT881467	hsa-miR-1273d	CLIP-seq
MIRT881468	hsa-miR-199b-3p	CLIP-seq
MIRT881469	hsa-miR-3129-5p	CLIP-seq
MIRT881470	hsa-miR-3152-5p	CLIP-seq
MIRT881471	hsa-miR-409-3p	CLIP-seq
MIRT881472	hsa-miR-4446-5p	CLIP-seq
MIRT881473	hsa-miR-4666-5p	CLIP-seq
MIRT881474	hsa-miR-4699-3p	CLIP-seq
MIRT881475	hsa-miR-4755-5p	CLIP-seq
MIRT881476	hsa-miR-4774-3p	CLIP-seq
MIRT881477	hsa-miR-4797-3p	CLIP-seq
MIRT881478	hsa-miR-520d-5p	CLIP-seq
MIRT881479	hsa-miR-524-5p	CLIP-seq
MIRT881480	hsa-miR-548c-3p	CLIP-seq
MIRT881481	hsa-miR-587	CLIP-seq
MIRT881482	hsa-miR-642a	CLIP-seq
MIRT881483	hsa-miR-885-5p	CLIP-seq
MIRT881484	hsa-miR-936	CLIP-seq
MIRT881474	hsa-miR-4699-3p	CLIP-seq
MIRT881481	hsa-miR-587	CLIP-seq
MIRT881483	hsa-miR-885-5p	CLIP-seq
MIRT2197887	hsa-miR-139-5p	CLIP-seq
MIRT2197888	hsa-miR-3120-3p	CLIP-seq
MIRT881471	hsa-miR-409-3p	CLIP-seq
MIRT2197889	hsa-miR-4310	CLIP-seq
MIRT881474	hsa-miR-4699-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	23622515
GO:0000439	Component	Transcription factor TFIIH core complex	IDA	8692841
GO:0001111	Process	RNA polymerase II promoter clearance	IDA	39603239, 39603240
GO:0001650	Component	Fibrillar center	IDA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	7533895
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	TAS	8208544
GO:0005515	Function	Protein binding	IPI	10801852, 10958787, 15530371, 16327805, 22939624, 23393140, 23455922, 23602568, 28514442, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10958787, 16109376
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7936635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005675	Component	Transcription factor TFIIH holo complex	IDA	9852112
GO:0005675	Component	Transcription factor TFIIH holo complex	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006366	Process	Transcription by RNA polymerase II	TAS
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IDA	7533895, 8692841, 26257281
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	TAS	7533895
GO:0006368	Process	Transcription elongation by RNA polymerase II	IDA	9852112, 16427012
GO:0006974	Process	DNA damage response	IEA
GO:0008094	Function	ATP-dependent activity, acting on DNA	IDA	9852112
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IBA
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IDA	9852112, 12721286
GO:0008353	Function	RNA polymerase II CTD heptapeptide repeat kinase activity	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IDA	39603239, 39603240
GO:0042795	Process	SnRNA transcription by RNA polymerase II	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	39504960, 39667934
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9852112
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050821	Process	Protein stabilization	IMP	23393140
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	TAS	15876871
GO:0070516	Component	CAK-ERCC2 complex	IDA	8692841
GO:0070985	Component	Transcription factor TFIIK complex	IBA
GO:0070985	Component	Transcription factor TFIIK complex	IDA	8692841
GO:0070985	Component	Transcription factor TFIIK complex	IEA
GO:0070985	Component	Transcription factor TFIIK complex	IMP	23393140
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140836	Function	RNA polymerase II CTD heptapeptide repeat S5 kinase activity	IDA	26257281
GO:0160239	Process	Transcription pausing by RNA polymerase II	IDA	9450929, 10199401
GO:0160240	Process	RNA polymerase II transcription initiation surveillance	IDA	32697989, 33243860, 39504960, 39667934
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IDA	23622515

Other IDs

• MIM: 601955
• HGNC: 1778
• e!Ensembl: ENSG00000134058

Protein

• UniProt ID: P50613
• Protein name: Cyclin-dependent kinase 7 (EC 2.7.11.22) (EC 2.7.11.23) (39 kDa protein kinase) (p39 Mo15) (CDK-activating kinase 1) (Cell division protein kinase 7) (Serine/threonine-protein kinase 1) (TFIIH basal transcription factor complex kinase subunit)
• Protein function: Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription (PubMed:9852112, PubMed:19136461, PubMed:26257281, PubMed:28768201). Cyclin-dependent kinases (CDKs) are activated by the binding to a cyc
• PDB: 1UA2 , 6O9L , 6XBZ , 6XD3 , 7B5O , 7B5Q , 7EGB , 7EGC , 7ENA , 7ENC , 7LBM , 7NVR , 8BVW , 8BYQ , 8GXQ , 8GXS , 8ORM , 8P4Z , 8P6V , 8P6W , 8P6X , 8P6Y , 8P6Z , 8P70 , 8P71 , 8P72 , 8P73 , 8P74 , 8P75 , 8P76 , 8P77 , 8P78 , 8P79 , 8P7L , 8PLZ , 8PYR , 8R99 , 8R9A , 8R9B , 8R9O , 8R9S , 8R9U , 8S0R , 8S0T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	12 → 295	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
  REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
  TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
  PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
  CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
  PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

• Sequence length: 346

Pathways

KEGG Pathway	Reactome Pathway
Basal transcription factors	Formation of RNA Pol II elongation complex
Nucleotide excision repair	Formation of the Early Elongation Complex
Cell cycle	Formation of Incision Complex in GG-NER
	RNA Polymerase II Pre-transcription Events
	Formation of TC-NER Pre-Incision Complex
	Transcription-Coupled Nucleotide Excision Repair (TC-NER)
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	TP53 Regulates Transcription of DNA Repair Genes
	RNA polymerase II transcribes snRNA genes
	Cyclin E associated events during G1/S transition
	Cyclin D associated events in G1
	Cyclin A/B1/B2 associated events during G2/M transition
	Cyclin A:Cdk2-associated events at S phase entry
	mRNA Capping
	RNA Polymerase I Transcription Initiation
	RNA Polymerase I Promoter Escape
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase I Transcription Termination
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Elongation
	RNA Polymerase II Transcription Initiation And Promoter Clearance
	RNA Pol II CTD phosphorylation and interaction with CE
	RUNX1 regulates transcription of genes involved in differentiation of HSCs

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CCNH 27 shared pathwaysBasal transcription factors, Nucleotide excision repair, Cell cycle, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, Formation of Incision Complex in GG-NER, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER) +15 more Related via 27 shared pathways including Basal transcription factors, Nucleotide excision repair. MNAT1 26 shared pathwaysBasal transcription factors, Nucleotide excision repair, Cyclin E associated events during G1/S transition , Cyclin A:Cdk2-associated events at S phase entry, Formation of Incision Complex in GG-NER, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER +14 more Related via 26 shared pathways including Basal transcription factors, Nucleotide excision repair. ERCC2 21 shared pathwaysBasal transcription factors, Nucleotide excision repair, Formation of Incision Complex in GG-NER, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, RNA Polymerase I Transcription Termination +9 more Related via 21 shared pathways including Basal transcription factors, Nucleotide excision repair. ERCC3 21 shared pathwaysBasal transcription factors, Nucleotide excision repair, Formation of Incision Complex in GG-NER, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, RNA Polymerase I Transcription Termination +9 more Related via 21 shared pathways including Basal transcription factors, Nucleotide excision repair. GTF2H5 21 shared pathwaysBasal transcription factors, Nucleotide excision repair, Formation of Incision Complex in GG-NER, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, RNA Polymerase I Transcription Termination +9 more Related via 21 shared pathways including Basal transcription factors, Nucleotide excision repair.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CCNH	0	[]	27	["Basal transcription factors","Nucleotide excision repair","Cell cycle","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","Formation of Incision Complex in GG-NER","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)"]	0	[]
MNAT1	0	[]	26	["Basal transcription factors","Nucleotide excision repair","Cyclin E associated events during G1\/S transition ","Cyclin A:Cdk2-associated events at S phase entry","Formation of Incision Complex in GG-NER","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER"]	0	[]
ERCC2	0	[]	21	["Basal transcription factors","Nucleotide excision repair","Formation of Incision Complex in GG-NER","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","RNA Polymerase I Transcription Termination"]	0	[]
ERCC3	0	[]	21	["Basal transcription factors","Nucleotide excision repair","Formation of Incision Complex in GG-NER","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","RNA Polymerase I Transcription Termination"]	0	[]
GTF2H5	0	[]	21	["Basal transcription factors","Nucleotide excision repair","Formation of Incision Complex in GG-NER","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","RNA Polymerase I Transcription Termination"]	0	[]

Diseases Linked via Similar Genes

Trichothiodystrophy Linked via 3 of 5 related genesERCC2, ERCC3, GTF2H5 Prostatic neoplasms Linked via 2 of 5 related genesCCNH, ERCC2 Xeroderma pigmentosum Linked via 2 of 5 related genesERCC2, ERCC3 Xeroderma pigmentosum-cockayne syndrome Linked via 2 of 5 related genesERCC2, ERCC3 Breast neoplasms Linked via 1 of 5 related genesCCNH

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Trichothiodystrophy	3	["ERCC2","ERCC3","GTF2H5"]
Prostatic neoplasms	2	["CCNH","ERCC2"]
Xeroderma pigmentosum	2	["ERCC2","ERCC3"]
Xeroderma pigmentosum-cockayne syndrome	2	["ERCC2","ERCC3"]
Breast neoplasms	1	["CCNH"]