CDK5R2 (cyclin dependent kinase 5 regulatory subunit 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 8941
• Gene name: Cyclin dependent kinase 5 regulatory subunit 2
• Gene symbol: CDK5R2
• Synonyms (NCBI Gene): NCK5AI, P39, p39nck5ai
• Chromosome: 2
• Chromosome location: 2q35
• Summary: The protein encoded by this gene is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define

miRNA Show/Hide all (33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020417	hsa-miR-106b-5p	Microarray	17242205
MIRT737618	hsa-miR-1324	CLIP-seq
MIRT881293	hsa-miR-185	CLIP-seq
MIRT881294	hsa-miR-3125	CLIP-seq
MIRT881295	hsa-miR-3166	CLIP-seq
MIRT881296	hsa-miR-3173-3p	CLIP-seq
MIRT881297	hsa-miR-3612	CLIP-seq
MIRT881298	hsa-miR-3916	CLIP-seq
MIRT881299	hsa-miR-4306	CLIP-seq
MIRT881300	hsa-miR-4419a	CLIP-seq
MIRT881301	hsa-miR-4426	CLIP-seq
MIRT881302	hsa-miR-4459	CLIP-seq
MIRT737619	hsa-miR-4497	CLIP-seq
MIRT881303	hsa-miR-4510	CLIP-seq
MIRT881304	hsa-miR-4643	CLIP-seq
MIRT881305	hsa-miR-4644	CLIP-seq
MIRT881306	hsa-miR-4647	CLIP-seq
MIRT881307	hsa-miR-4662b	CLIP-seq
MIRT881308	hsa-miR-4694-3p	CLIP-seq
MIRT881309	hsa-miR-4695-5p	CLIP-seq
MIRT881310	hsa-miR-4708-5p	CLIP-seq
MIRT881311	hsa-miR-4771	CLIP-seq
MIRT881312	hsa-miR-4779	CLIP-seq
MIRT881313	hsa-miR-642b	CLIP-seq
MIRT881314	hsa-miR-650	CLIP-seq
MIRT2197778	hsa-miR-3185	CLIP-seq
MIRT2197779	hsa-miR-3714	CLIP-seq
MIRT881302	hsa-miR-4459	CLIP-seq
MIRT2197780	hsa-miR-4731-3p	CLIP-seq
MIRT2197781	hsa-miR-4801	CLIP-seq
MIRT881313	hsa-miR-642b	CLIP-seq
MIRT2197782	hsa-miR-764	CLIP-seq
MIRT2197783	hsa-miR-765	CLIP-seq

Gene ontology (GO) Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	7592934
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	ISS
GO:0001764	Process	Neuron migration	IEA
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0007420	Process	Brain development	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016533	Component	Protein kinase 5 complex	IEA
GO:0016533	Component	Protein kinase 5 complex	ISS
GO:0019901	Function	Protein kinase binding	IBA
GO:0021549	Process	Cerebellum development	IEA
GO:0021722	Process	Superior olivary nucleus maturation	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021819	Process	Layer formation in cerebral cortex	IEA
GO:0030426	Component	Growth cone	IBA
GO:0030426	Component	Growth cone	IEA
GO:0030426	Component	Growth cone	ISS
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0045956	Process	Positive regulation of calcium ion-dependent exocytosis	IEA
GO:0051493	Process	Regulation of cytoskeleton organization	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IBA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	ISS
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	TAS	17491008
GO:0098793	Component	Presynapse	IEA

Other IDs

• MIM: 603764
• HGNC: 1776
• e!Ensembl: ENSG00000171450

Protein

• UniProt ID: Q13319
• Protein name: Cyclin-dependent kinase 5 activator 2 (CDK5 activator 2) (Cyclin-dependent kinase 5 regulatory subunit 2) (p39) (p39I)
• Protein function: Activator of CDK5/TPKII.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03261	CDK5_activator	165 → 331	Cyclin-dependent kinase 5 activator protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Brain and neuron specific.
• Sequence:

  MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVL
  ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKP
  LAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQ
  ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
  LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
  IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKH
  WTMNLDR

• Sequence length: 367

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBACEOUS GLAND DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	15917097		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21825040		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30452490		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21825040	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	22741533	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30452490	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30452490		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21825040		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30452490		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21825040		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21825040	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30452490		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	36713370	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for CDK5R2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CDK5R2.