CDK4 (cyclin dependent kinase 4)

Gene

• Entrez ID: 1019
• Gene name: Cyclin dependent kinase 4
• Gene symbol: CDK4
• Synonyms (NCBI Gene): CMM3, PSK-J3
• Chromosome: 12
• Chromosome location: 12q14.1
• Summary: The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs11547328	G>A,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs104894340	C>A,T	Risk-factor, likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs144890720	T>C	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000765	hsa-miR-34c-5p	Review, Luciferase reporter assay	19461653
MIRT000764	hsa-miR-34b-5p	Review, Luciferase reporter assay	19461653
MIRT000763	hsa-miR-34a-5p	Review, Luciferase reporter assay	19461653
MIRT000763	hsa-miR-34a-5p	Review, Luciferase reporter assay, Western blot, Microarray	17914404
MIRT003636	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, Western blot	18710938
MIRT000763	hsa-miR-34a-5p	Review	19815577
MIRT000763	hsa-miR-34a-5p	Review	20130964
MIRT003450	hsa-miR-34b-3p	Review	20130964
MIRT000765	hsa-miR-34c-5p	Review	20130964
MIRT003313	hsa-let-7b-5p	Review	20179807
MIRT003450	hsa-miR-34b-3p	Microarray, Western blot, RTPCR	20924086
MIRT000765	hsa-miR-34c-5p	Microarray, Western blot, RTPCR	20924086
MIRT000117	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT000117	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT002625	hsa-miR-124-3p	Microarray	15685193
MIRT005879	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	21092188
MIRT006252	hsa-miR-195-5p	Luciferase reporter assay	22289176
MIRT006252	hsa-miR-195-5p	Luciferase reporter assay	22289176
MIRT006252	hsa-miR-195-5p	Luciferase reporter assay	22289176
MIRT006252	hsa-miR-195-5p	Luciferase reporter assay	22289176
MIRT006252	hsa-miR-195-5p	Luciferase reporter assay	22289176
MIRT006252	hsa-miR-195-5p	Luciferase reporter assay	22289176
MIRT016137	hsa-miR-449b-5p	Western blot	19833767
MIRT016631	hsa-miR-449a	Western blot	19833767
MIRT021016	hsa-miR-155-5p	Proteomics	18668040
MIRT002625	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT002625	hsa-miR-124-3p	Microarray	15685193
MIRT023403	hsa-miR-122-5p	Reporter assay	21750653
MIRT024107	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT000763	hsa-miR-34a-5p	qRT-PCR	21240262
MIRT000763	hsa-miR-34a-5p	Western blot	21128241
MIRT000117	hsa-miR-24-3p	Microarray	19748357
MIRT000117	hsa-miR-24-3p	Reporter assay;Western blot;qRT-PCR;Other	19748357
MIRT002625	hsa-miR-124-3p	Luciferase reporter assay, Western blot	23761023
MIRT050205	hsa-miR-25-3p	CLASH	23622248
MIRT046412	hsa-miR-15b-5p	CLASH	23622248
MIRT044439	hsa-miR-320a	CLASH	23622248
MIRT041351	hsa-miR-193b-3p	CLASH	23622248
MIRT039027	hsa-miR-766-3p	CLASH	23622248
MIRT052933	hsa-miR-206	Luciferase reporter assay, Microarray	24289491
MIRT054384	hsa-miR-545-3p	Luciferase reporter assay, qRT-PCR, Western blot	24505359
MIRT054620	hsa-miR-506-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24604117
MIRT054620	hsa-miR-506-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24604117
MIRT002625	hsa-miR-124-3p	Luciferase reporter assay, Western blot	23404119
MIRT006252	hsa-miR-195-5p	Luciferase reporter assay, Western blot	23544130
MIRT437795	hsa-miR-497-5p	Luciferase reporter assay, Western blot	23544130
MIRT437861	hsa-miR-483-3p	Immunoblot, Immunofluorescence, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR	23429262
MIRT438347	hsa-miR-29a-3p	qRT-PCR, Western blot	25889078
MIRT000763	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT000763	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT438347	hsa-miR-29a-3p	qRT-PCR, Western blot	25889078
MIRT000763	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT000763	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT678575	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT678574	hsa-miR-764	HITS-CLIP	23824327
MIRT678573	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT678572	hsa-miR-1471	HITS-CLIP	23824327
MIRT678571	hsa-miR-1306-3p	HITS-CLIP	23824327
MIRT678570	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT678569	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT678568	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678567	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT678566	hsa-miR-640	HITS-CLIP	23824327
MIRT678565	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT672191	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT636666	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT636665	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT636664	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT636663	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT636662	hsa-miR-3666	HITS-CLIP	23824327
MIRT636661	hsa-miR-4295	HITS-CLIP	23824327
MIRT636660	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT672190	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT672189	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT672188	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT636659	hsa-miR-1267	HITS-CLIP	23824327
MIRT636658	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT636657	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT636655	hsa-miR-3135b	HITS-CLIP	23824327
MIRT636654	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT023403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT636653	hsa-miR-3622b-5p	HITS-CLIP	23824327
MIRT672187	hsa-miR-4284	HITS-CLIP	23824327
MIRT636652	hsa-miR-3652	HITS-CLIP	23824327
MIRT636651	hsa-miR-4430	HITS-CLIP	23824327
MIRT636649	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT636648	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT636647	hsa-miR-7641	HITS-CLIP	23824327
MIRT636646	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT636643	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT636666	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT636665	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT636664	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT636663	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT636662	hsa-miR-3666	HITS-CLIP	23824327
MIRT636661	hsa-miR-4295	HITS-CLIP	23824327
MIRT636660	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT636659	hsa-miR-1267	HITS-CLIP	23824327
MIRT636658	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT636657	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT636656	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT636655	hsa-miR-3135b	HITS-CLIP	23824327
MIRT636654	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT023403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT636653	hsa-miR-3622b-5p	HITS-CLIP	23824327
MIRT636652	hsa-miR-3652	HITS-CLIP	23824327
MIRT636651	hsa-miR-4430	HITS-CLIP	23824327
MIRT636650	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT636649	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT636648	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT636647	hsa-miR-7641	HITS-CLIP	23824327
MIRT636646	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT636645	hsa-miR-5691	HITS-CLIP	23824327
MIRT636644	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT636643	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT054620	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT502906	hsa-miR-548ab	PAR-CLIP	20371350
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT502902	hsa-miR-548ak	PAR-CLIP	20371350
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT502890	hsa-miR-548i	PAR-CLIP	20371350
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT502887	hsa-miR-548w	PAR-CLIP	20371350
MIRT502886	hsa-miR-548y	PAR-CLIP	20371350
MIRT502885	hsa-miR-559	PAR-CLIP	20371350
MIRT502883	hsa-miR-3714	PAR-CLIP	20371350
MIRT502884	hsa-miR-3910	PAR-CLIP	20371350
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	20371350
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	20371350
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT502879	hsa-miR-3973	PAR-CLIP	20371350
MIRT054384	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT502878	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT054620	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT502906	hsa-miR-548ab	PAR-CLIP	20371350
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT502902	hsa-miR-548ak	PAR-CLIP	20371350
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT502890	hsa-miR-548i	PAR-CLIP	20371350
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT502887	hsa-miR-548w	PAR-CLIP	20371350
MIRT502886	hsa-miR-548y	PAR-CLIP	20371350
MIRT502885	hsa-miR-559	PAR-CLIP	20371350
MIRT502883	hsa-miR-3714	PAR-CLIP	20371350
MIRT502884	hsa-miR-3910	PAR-CLIP	20371350
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	20371350
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	20371350
MIRT502879	hsa-miR-3973	PAR-CLIP	20371350
MIRT054384	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT502878	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT054620	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT502906	hsa-miR-548ab	PAR-CLIP	20371350
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT502902	hsa-miR-548ak	PAR-CLIP	20371350
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT502890	hsa-miR-548i	PAR-CLIP	20371350
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT502887	hsa-miR-548w	PAR-CLIP	20371350
MIRT502886	hsa-miR-548y	PAR-CLIP	20371350
MIRT502885	hsa-miR-559	PAR-CLIP	20371350
MIRT502883	hsa-miR-3714	PAR-CLIP	20371350
MIRT502884	hsa-miR-3910	PAR-CLIP	20371350
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	20371350
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	20371350
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT502879	hsa-miR-3973	PAR-CLIP	20371350
MIRT054384	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT502878	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT054620	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT502906	hsa-miR-548ab	PAR-CLIP	20371350
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT502902	hsa-miR-548ak	PAR-CLIP	20371350
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT502890	hsa-miR-548i	PAR-CLIP	20371350
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT502887	hsa-miR-548w	PAR-CLIP	20371350
MIRT502886	hsa-miR-548y	PAR-CLIP	20371350
MIRT502885	hsa-miR-559	PAR-CLIP	20371350
MIRT502883	hsa-miR-3714	PAR-CLIP	20371350
MIRT502884	hsa-miR-3910	PAR-CLIP	20371350
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	20371350
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	20371350
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT502879	hsa-miR-3973	PAR-CLIP	20371350
MIRT054384	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT502878	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	21572407
MIRT054620	hsa-miR-506-3p	PAR-CLIP	21572407
MIRT002625	hsa-miR-124-3p	PAR-CLIP	21572407
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT502906	hsa-miR-548ab	PAR-CLIP	21572407
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT502902	hsa-miR-548ak	PAR-CLIP	21572407
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT502890	hsa-miR-548i	PAR-CLIP	21572407
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT502887	hsa-miR-548w	PAR-CLIP	21572407
MIRT502886	hsa-miR-548y	PAR-CLIP	21572407
MIRT502885	hsa-miR-559	PAR-CLIP	21572407
MIRT502883	hsa-miR-3714	PAR-CLIP	21572407
MIRT502884	hsa-miR-3910	PAR-CLIP	21572407
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	21572407
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	21572407
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	21572407
MIRT502879	hsa-miR-3973	PAR-CLIP	21572407
MIRT054384	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT548929	hsa-miR-3137	PAR-CLIP	21572407
MIRT548928	hsa-miR-20b-3p	PAR-CLIP	21572407
MIRT502878	hsa-miR-616-3p	PAR-CLIP	21572407
MIRT002625	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT054620	hsa-miR-506-3p	PAR-CLIP	23446348
MIRT002625	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	23446348
MIRT502906	hsa-miR-548ab	PAR-CLIP	23446348
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	23446348
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	23446348
MIRT502902	hsa-miR-548ak	PAR-CLIP	23446348
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	23446348
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	23446348
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	23446348
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	23446348
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	23446348
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	23446348
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	23446348
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	23446348
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	23446348
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	23446348
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	23446348
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	23446348
MIRT502890	hsa-miR-548i	PAR-CLIP	23446348
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	23446348
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	23446348
MIRT502887	hsa-miR-548w	PAR-CLIP	23446348
MIRT502886	hsa-miR-548y	PAR-CLIP	23446348
MIRT502885	hsa-miR-559	PAR-CLIP	23446348
MIRT502883	hsa-miR-3714	PAR-CLIP	23446348
MIRT502884	hsa-miR-3910	PAR-CLIP	23446348
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	23446348
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	23446348
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT502879	hsa-miR-3973	PAR-CLIP	23446348
MIRT054384	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT502878	hsa-miR-616-3p	PAR-CLIP	23446348
MIRT002625	hsa-miR-124-3p	PAR-CLIP	24398324
MIRT054620	hsa-miR-506-3p	PAR-CLIP	24398324
MIRT002625	hsa-miR-124-3p	PAR-CLIP	24398324
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	24398324
MIRT502906	hsa-miR-548ab	PAR-CLIP	24398324
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	24398324
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	24398324
MIRT502902	hsa-miR-548ak	PAR-CLIP	24398324
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	24398324
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	24398324
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	24398324
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	24398324
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	24398324
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	24398324
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	24398324
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	24398324
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	24398324
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	24398324
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	24398324
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	24398324
MIRT502890	hsa-miR-548i	PAR-CLIP	24398324
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	24398324
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	24398324
MIRT502887	hsa-miR-548w	PAR-CLIP	24398324
MIRT502886	hsa-miR-548y	PAR-CLIP	24398324
MIRT502885	hsa-miR-559	PAR-CLIP	24398324
MIRT502883	hsa-miR-3714	PAR-CLIP	24398324
MIRT502884	hsa-miR-3910	PAR-CLIP	24398324
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	24398324
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	24398324
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	24398324
MIRT502879	hsa-miR-3973	PAR-CLIP	24398324
MIRT054384	hsa-miR-545-3p	PAR-CLIP	24398324
MIRT502878	hsa-miR-616-3p	PAR-CLIP	24398324
MIRT731583	hsa-miR-486-5p	Luciferase reporter assay	27049724
MIRT731583	hsa-miR-486-5p	Luciferase reporter assay	27049724
MIRT732106	hsa-miR-539-5p	Luciferase reporter assay, qRT-PCR, Western blot	26559153
MIRT732106	hsa-miR-539-5p	Luciferase reporter assay, qRT-PCR, Western blot	26559153
MIRT024107	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	28159933
MIRT024107	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	28159933
MIRT002625	hsa-miR-124-3p	Luciferase reporter assay	27323123
MIRT002625	hsa-miR-124-3p	Luciferase reporter assay	27323123
MIRT024107	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	27247259
MIRT731583	hsa-miR-486-5p	Western blotting	33955505
MIRT000763	hsa-miR-34a-5p	Immunocytochemistry (ICC), RNA-seq, qRT-PCR	33748099
MIRT000765	hsa-miR-34c-5p	Immunocytochemistry (ICC), RNA-seq, qRT-PCR	33748099
MIRT437861	hsa-miR-483-3p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR	23429262
MIRT737468	hsa-miR-223-3p	Western blotting, Immunofluorescence, qRT-PCR	31862778
MIRT678575	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT678574	hsa-miR-764	HITS-CLIP	23824327
MIRT678573	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT678572	hsa-miR-1471	HITS-CLIP	23824327
MIRT678571	hsa-miR-1306-3p	HITS-CLIP	23824327
MIRT678570	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT678569	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT678568	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT678567	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT678566	hsa-miR-640	HITS-CLIP	23824327
MIRT678565	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT672191	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT636666	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT636665	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT636664	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT636663	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT636662	hsa-miR-3666	HITS-CLIP	23824327
MIRT636661	hsa-miR-4295	HITS-CLIP	23824327
MIRT636660	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT672190	hsa-miR-6741-3p	HITS-CLIP	23824327
MIRT672189	hsa-miR-1307-3p	HITS-CLIP	23824327
MIRT672188	hsa-miR-4638-5p	HITS-CLIP	23824327
MIRT636659	hsa-miR-1267	HITS-CLIP	23824327
MIRT636658	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT636657	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT636655	hsa-miR-3135b	HITS-CLIP	23824327
MIRT636654	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT023403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT636653	hsa-miR-3622b-5p	HITS-CLIP	23824327
MIRT672187	hsa-miR-4284	HITS-CLIP	23824327
MIRT636652	hsa-miR-3652	HITS-CLIP	23824327
MIRT636651	hsa-miR-4430	HITS-CLIP	23824327
MIRT636649	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT636648	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT636647	hsa-miR-7641	HITS-CLIP	23824327
MIRT636646	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT636643	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT636666	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT636665	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT636664	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT636663	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT636662	hsa-miR-3666	HITS-CLIP	23824327
MIRT636661	hsa-miR-4295	HITS-CLIP	23824327
MIRT636660	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT636659	hsa-miR-1267	HITS-CLIP	23824327
MIRT636658	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT636657	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT636656	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT636655	hsa-miR-3135b	HITS-CLIP	23824327
MIRT636654	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT023403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT636653	hsa-miR-3622b-5p	HITS-CLIP	23824327
MIRT636652	hsa-miR-3652	HITS-CLIP	23824327
MIRT636651	hsa-miR-4430	HITS-CLIP	23824327
MIRT636650	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT636649	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT636648	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT636647	hsa-miR-7641	HITS-CLIP	23824327
MIRT636646	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT636645	hsa-miR-5691	HITS-CLIP	23824327
MIRT636644	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT636643	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT054620	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT502906	hsa-miR-548ab	PAR-CLIP	20371350
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT502902	hsa-miR-548ak	PAR-CLIP	20371350
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT502890	hsa-miR-548i	PAR-CLIP	20371350
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT502887	hsa-miR-548w	PAR-CLIP	20371350
MIRT502886	hsa-miR-548y	PAR-CLIP	20371350
MIRT502885	hsa-miR-559	PAR-CLIP	20371350
MIRT502883	hsa-miR-3714	PAR-CLIP	20371350
MIRT502884	hsa-miR-3910	PAR-CLIP	20371350
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	20371350
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	20371350
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT502879	hsa-miR-3973	PAR-CLIP	20371350
MIRT054384	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT502878	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT054620	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT502906	hsa-miR-548ab	PAR-CLIP	20371350
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT502902	hsa-miR-548ak	PAR-CLIP	20371350
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT502890	hsa-miR-548i	PAR-CLIP	20371350
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT502887	hsa-miR-548w	PAR-CLIP	20371350
MIRT502886	hsa-miR-548y	PAR-CLIP	20371350
MIRT502885	hsa-miR-559	PAR-CLIP	20371350
MIRT502883	hsa-miR-3714	PAR-CLIP	20371350
MIRT502884	hsa-miR-3910	PAR-CLIP	20371350
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	20371350
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	20371350
MIRT502879	hsa-miR-3973	PAR-CLIP	20371350
MIRT054384	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT502878	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT054620	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT502906	hsa-miR-548ab	PAR-CLIP	20371350
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT502902	hsa-miR-548ak	PAR-CLIP	20371350
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT502890	hsa-miR-548i	PAR-CLIP	20371350
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT502887	hsa-miR-548w	PAR-CLIP	20371350
MIRT502886	hsa-miR-548y	PAR-CLIP	20371350
MIRT502885	hsa-miR-559	PAR-CLIP	20371350
MIRT502883	hsa-miR-3714	PAR-CLIP	20371350
MIRT502884	hsa-miR-3910	PAR-CLIP	20371350
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	20371350
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	20371350
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT502879	hsa-miR-3973	PAR-CLIP	20371350
MIRT054384	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT502878	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT054620	hsa-miR-506-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT502906	hsa-miR-548ab	PAR-CLIP	20371350
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT502902	hsa-miR-548ak	PAR-CLIP	20371350
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT502890	hsa-miR-548i	PAR-CLIP	20371350
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT502887	hsa-miR-548w	PAR-CLIP	20371350
MIRT502886	hsa-miR-548y	PAR-CLIP	20371350
MIRT502885	hsa-miR-559	PAR-CLIP	20371350
MIRT502883	hsa-miR-3714	PAR-CLIP	20371350
MIRT502884	hsa-miR-3910	PAR-CLIP	20371350
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	20371350
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	20371350
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT502879	hsa-miR-3973	PAR-CLIP	20371350
MIRT054384	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT502878	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT002625	hsa-miR-124-3p	PAR-CLIP	21572407
MIRT054620	hsa-miR-506-3p	PAR-CLIP	21572407
MIRT002625	hsa-miR-124-3p	PAR-CLIP	21572407
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT502906	hsa-miR-548ab	PAR-CLIP	21572407
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT502902	hsa-miR-548ak	PAR-CLIP	21572407
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT502890	hsa-miR-548i	PAR-CLIP	21572407
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT502887	hsa-miR-548w	PAR-CLIP	21572407
MIRT502886	hsa-miR-548y	PAR-CLIP	21572407
MIRT502885	hsa-miR-559	PAR-CLIP	21572407
MIRT502883	hsa-miR-3714	PAR-CLIP	21572407
MIRT502884	hsa-miR-3910	PAR-CLIP	21572407
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	21572407
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	21572407
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	21572407
MIRT502879	hsa-miR-3973	PAR-CLIP	21572407
MIRT054384	hsa-miR-545-3p	PAR-CLIP	21572407
MIRT548929	hsa-miR-3137	PAR-CLIP	21572407
MIRT548928	hsa-miR-20b-3p	PAR-CLIP	21572407
MIRT502878	hsa-miR-616-3p	PAR-CLIP	21572407
MIRT002625	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT054620	hsa-miR-506-3p	PAR-CLIP	23446348
MIRT002625	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	23446348
MIRT502906	hsa-miR-548ab	PAR-CLIP	23446348
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	23446348
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	23446348
MIRT502902	hsa-miR-548ak	PAR-CLIP	23446348
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	23446348
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	23446348
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	23446348
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	23446348
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	23446348
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	23446348
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	23446348
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	23446348
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	23446348
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	23446348
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	23446348
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	23446348
MIRT502890	hsa-miR-548i	PAR-CLIP	23446348
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	23446348
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	23446348
MIRT502887	hsa-miR-548w	PAR-CLIP	23446348
MIRT502886	hsa-miR-548y	PAR-CLIP	23446348
MIRT502885	hsa-miR-559	PAR-CLIP	23446348
MIRT502883	hsa-miR-3714	PAR-CLIP	23446348
MIRT502884	hsa-miR-3910	PAR-CLIP	23446348
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	23446348
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	23446348
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	23446348
MIRT502879	hsa-miR-3973	PAR-CLIP	23446348
MIRT054384	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT502878	hsa-miR-616-3p	PAR-CLIP	23446348
MIRT002625	hsa-miR-124-3p	PAR-CLIP	24398324
MIRT054620	hsa-miR-506-3p	PAR-CLIP	24398324
MIRT002625	hsa-miR-124-3p	PAR-CLIP	24398324
MIRT502907	hsa-miR-548a-5p	PAR-CLIP	24398324
MIRT502906	hsa-miR-548ab	PAR-CLIP	24398324
MIRT502905	hsa-miR-548ad-5p	PAR-CLIP	24398324
MIRT502904	hsa-miR-548ae-5p	PAR-CLIP	24398324
MIRT502902	hsa-miR-548ak	PAR-CLIP	24398324
MIRT502903	hsa-miR-548am-5p	PAR-CLIP	24398324
MIRT502901	hsa-miR-548ap-5p	PAR-CLIP	24398324
MIRT502900	hsa-miR-548aq-5p	PAR-CLIP	24398324
MIRT502899	hsa-miR-548ar-5p	PAR-CLIP	24398324
MIRT502898	hsa-miR-548as-5p	PAR-CLIP	24398324
MIRT502897	hsa-miR-548au-5p	PAR-CLIP	24398324
MIRT502896	hsa-miR-548ay-5p	PAR-CLIP	24398324
MIRT502895	hsa-miR-548b-5p	PAR-CLIP	24398324
MIRT502894	hsa-miR-548bb-5p	PAR-CLIP	24398324
MIRT502893	hsa-miR-548c-5p	PAR-CLIP	24398324
MIRT502892	hsa-miR-548d-5p	PAR-CLIP	24398324
MIRT502891	hsa-miR-548h-5p	PAR-CLIP	24398324
MIRT502890	hsa-miR-548i	PAR-CLIP	24398324
MIRT502889	hsa-miR-548j-5p	PAR-CLIP	24398324
MIRT502888	hsa-miR-548o-5p	PAR-CLIP	24398324
MIRT502887	hsa-miR-548w	PAR-CLIP	24398324
MIRT502886	hsa-miR-548y	PAR-CLIP	24398324
MIRT502885	hsa-miR-559	PAR-CLIP	24398324
MIRT502883	hsa-miR-3714	PAR-CLIP	24398324
MIRT502884	hsa-miR-3910	PAR-CLIP	24398324
MIRT502882	hsa-miR-216a-5p	PAR-CLIP	24398324
MIRT502881	hsa-miR-216b-5p	PAR-CLIP	24398324
MIRT502880	hsa-miR-513b-3p	PAR-CLIP	24398324
MIRT502879	hsa-miR-3973	PAR-CLIP	24398324
MIRT054384	hsa-miR-545-3p	PAR-CLIP	24398324
MIRT502878	hsa-miR-616-3p	PAR-CLIP	24398324
MIRT755539	hsa-miR-181c-5p	Western blotting, qRT-PCR	36676955
MIRT755934	hsa-miR-7-5p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays, RNA pull down assay	34719318
MIRT881148	hsa-miR-1	CLIP-seq
MIRT881149	hsa-miR-103b	CLIP-seq
MIRT881150	hsa-miR-124	CLIP-seq
MIRT881151	hsa-miR-142-5p	CLIP-seq
MIRT881152	hsa-miR-216a	CLIP-seq
MIRT881153	hsa-miR-216b	CLIP-seq
MIRT881154	hsa-miR-3123	CLIP-seq
MIRT881155	hsa-miR-3153	CLIP-seq
MIRT881156	hsa-miR-3157-3p	CLIP-seq
MIRT881157	hsa-miR-340	CLIP-seq
MIRT881158	hsa-miR-3591-5p	CLIP-seq
MIRT881159	hsa-miR-3919	CLIP-seq
MIRT881160	hsa-miR-3925-5p	CLIP-seq
MIRT881161	hsa-miR-4264	CLIP-seq
MIRT881162	hsa-miR-4280	CLIP-seq
MIRT881163	hsa-miR-4290	CLIP-seq
MIRT881164	hsa-miR-4302	CLIP-seq
MIRT881165	hsa-miR-4426	CLIP-seq
MIRT881166	hsa-miR-4428	CLIP-seq
MIRT881167	hsa-miR-4434	CLIP-seq
MIRT881168	hsa-miR-4475	CLIP-seq
MIRT881169	hsa-miR-4484	CLIP-seq
MIRT881170	hsa-miR-4516	CLIP-seq
MIRT881171	hsa-miR-4533	CLIP-seq
MIRT881172	hsa-miR-4534	CLIP-seq
MIRT881173	hsa-miR-4647	CLIP-seq
MIRT881174	hsa-miR-4662b	CLIP-seq
MIRT881175	hsa-miR-4732-5p	CLIP-seq
MIRT881176	hsa-miR-4747-5p	CLIP-seq
MIRT881177	hsa-miR-4751	CLIP-seq
MIRT881178	hsa-miR-4756-3p	CLIP-seq
MIRT881179	hsa-miR-4797-3p	CLIP-seq
MIRT881180	hsa-miR-4802-5p	CLIP-seq
MIRT881181	hsa-miR-506	CLIP-seq
MIRT881182	hsa-miR-539	CLIP-seq
MIRT881183	hsa-miR-545	CLIP-seq
MIRT881184	hsa-miR-548an	CLIP-seq
MIRT881185	hsa-miR-548h	CLIP-seq
MIRT881186	hsa-miR-548j	CLIP-seq
MIRT881187	hsa-miR-548m	CLIP-seq
MIRT881188	hsa-miR-577	CLIP-seq
MIRT881189	hsa-miR-616	CLIP-seq
MIRT881190	hsa-miR-765	CLIP-seq
MIRT881191	hsa-miR-874	CLIP-seq
MIRT881148	hsa-miR-1	CLIP-seq
MIRT1961013	hsa-miR-198	CLIP-seq
MIRT881154	hsa-miR-3123	CLIP-seq
MIRT1961014	hsa-miR-3154	CLIP-seq
MIRT1961015	hsa-miR-371b-5p	CLIP-seq
MIRT881160	hsa-miR-3925-5p	CLIP-seq
MIRT881161	hsa-miR-4264	CLIP-seq
MIRT881164	hsa-miR-4302	CLIP-seq
MIRT881166	hsa-miR-4428	CLIP-seq
MIRT881167	hsa-miR-4434	CLIP-seq
MIRT881170	hsa-miR-4516	CLIP-seq
MIRT881171	hsa-miR-4533	CLIP-seq
MIRT881175	hsa-miR-4732-5p	CLIP-seq
MIRT881176	hsa-miR-4747-5p	CLIP-seq
MIRT881179	hsa-miR-4797-3p	CLIP-seq
MIRT881182	hsa-miR-539	CLIP-seq
MIRT1961016	hsa-miR-885-3p	CLIP-seq
MIRT881148	hsa-miR-1	CLIP-seq
MIRT881150	hsa-miR-124	CLIP-seq
MIRT881152	hsa-miR-216a	CLIP-seq
MIRT881153	hsa-miR-216b	CLIP-seq
MIRT2197751	hsa-miR-3689a-3p	CLIP-seq
MIRT2197752	hsa-miR-3689c	CLIP-seq
MIRT881165	hsa-miR-4426	CLIP-seq
MIRT881166	hsa-miR-4428	CLIP-seq
MIRT881167	hsa-miR-4434	CLIP-seq
MIRT881170	hsa-miR-4516	CLIP-seq
MIRT881173	hsa-miR-4647	CLIP-seq
MIRT881174	hsa-miR-4662b	CLIP-seq
MIRT2197753	hsa-miR-4728-5p	CLIP-seq
MIRT881181	hsa-miR-506	CLIP-seq
MIRT881183	hsa-miR-545	CLIP-seq
MIRT881185	hsa-miR-548h	CLIP-seq
MIRT881186	hsa-miR-548j	CLIP-seq
MIRT881189	hsa-miR-616	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ESR1	Unknown	22179484
IRF1	Repression	22200613
MYC	Activation	22395148
MYC	Unknown	10688915;21384303
NFKB1	Activation	18425349
NR3C1	Repression	9154817
RELA	Activation	18425349
SATB1	Activation	22583549
SOX6	Repression	21084391
SOX9	Activation	20651055
SOX9	Repression	20651055
SP1	Activation	19017637
STAT3	Activation	22218594
TP53	Unknown	17530187

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	19237565
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IMP	7603984
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	7603984
GO:0000166	Function	Nucleotide binding	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	17420273, 18827403
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IEA
GO:0000785	Component	Chromatin	IDA	18827403
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IDA	8114739, 19237565
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	7568034, 8078588, 8259215, 8741839, 8756624, 9106657, 9150368, 9529249, 11896535, 11900540, 14641107, 15107404, 15232106, 15558030, 15681588, 16169070, 16189514, 16326706, 16327805, 16431923, 16962592, 17053782, 17517622, 17909018, 17955473, 19237555, 19237565, 19447967, 19470470, 20
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16109376, 18827403, 20399237
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005730	Component	Nucleolus	IDA	18827403
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	18827403
GO:0005829	Component	Cytosol	TAS
GO:0005923	Component	Bicellular tight junction	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	7603984
GO:0009410	Process	Response to xenobiotic stimulus	IEP	18291362
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	IBA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IMP	17420273
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IDA	19124461
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0030332	Function	Cyclin binding	IBA
GO:0030332	Function	Cyclin binding	IEA
GO:0030332	Function	Cyclin binding	IPI	19124461
GO:0031965	Component	Nuclear membrane	IDA	18827403
GO:0031965	Component	Nuclear membrane	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	17420273
GO:0051301	Process	Cell division	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	19124461
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060260	Process	Regulation of transcription initiation by RNA polymerase II	TAS
GO:0061469	Process	Regulation of type B pancreatic cell proliferation	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0097128	Component	Cyclin D1-CDK4 complex	IEA
GO:0097128	Component	Cyclin D1-CDK4 complex	IPI	19237565
GO:0097129	Component	Cyclin D2-CDK4 complex	IEA
GO:0097129	Component	Cyclin D2-CDK4 complex	IPI	11896535
GO:0097130	Component	Cyclin D3-CDK4 complex	IPI	19237555
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1904628	Process	Cellular response to phorbol 13-acetate 12-myristate	IEA
GO:1904637	Process	Cellular response to ionomycin	IEA

Other IDs

• MIM: 123829
• HGNC: 1773
• e!Ensembl: ENSG00000135446

Protein

• UniProt ID: P11802
• Protein name: Cyclin-dependent kinase 4 (EC 2.7.11.22) (Cell division protein kinase 4) (PSK-J3)
• Protein function: Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociat
• PDB: 2W96, 2W99, 2W9F, 2W9Z, 3G33, 5FWK, 5FWL, 5FWM, 5FWP, 6P8E, 6P8F, 6P8G, 6P8H, 7SJ3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	6 → 295	Protein kinase domain	Domain

• Sequence:

  MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
  RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
  MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
  RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
  DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
  NPE

• Sequence length: 303

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Familial melanoma	Pathogenic	rs11547328, rs104894340	RCV000168188 RCV001851913	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gastric cancer	Pathogenic	rs1372968634	RCV003164624	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary cancer-predisposing syndrome	Pathogenic	rs11547328, rs104894340	RCV000584153 RCV001026151	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Melanoma, cutaneous malignant, susceptibility to, 3	Pathogenic	rs11547328, rs104894340	RCV000018436 RCV000018437	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN STEM NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CDK4-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cutaneous Malignant Melanoma, Dominant	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEDIFFERENTIATED LIPOSARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewing sarcoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT PANCREATIC NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA, CUTANEOUS MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE NEGATIVE BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WELL-DIFFERENTIATED LIPOSARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Actinic keratosis	Actinic keratosis	BEFREE	10498902		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24504520		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	11301189, 29995568, 7630199, 9355972, 9827921		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18172308, 29735403		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	11299766, 29245989		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	14647414, 20651055, 23792647, 26418953, 27151654, 28364361, 31516564		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	14562378, 17072968, 29852762		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	17072968		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	20572039		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25078331, 29283884, 29581542, 30413320, 32373071, 35462410	Associate	★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	29283884		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25675863, 29995568		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	10803523		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	18503581		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21325289		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	27012813, 28637687		★☆☆☆☆ Found in Text Mining only
Albinism Oculocutaneous	Oculocutaneous albinism	Pubtator	23103111	Associate	★☆☆☆☆ Found in Text Mining only
Albinism, Oculocutaneous	Oculocutaneous albinism	BEFREE	27776349		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	24551291, 9823299		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	9176387, 9525997	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	20923449		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	11763427, 17214366		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	10667596, 16319692, 7987821		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462, 14522882		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	11764090, 18544654		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30191474		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29470723		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22869556, 24986516, 29735403, 30696953, 31745297		★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	27251476	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21676922	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10764044, 15970925, 19143767, 23737970, 29016839, 31177992, 31733156, 32641004	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11325859, 12127399, 19143767, 31177992, 8760309, 8847566, 8857999		★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	26637365		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11291051, 24614102, 28123545, 31231312, 31849147, 9546285		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	11299766		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10640976		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	33060611	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14508527, 18361427, 23276138, 25348738, 26318986, 30242024, 31190856, 31331377		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	8555065		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	32783178, 33307492, 37875500	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	9703873		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	20932960		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	28717243, 31079218, 31307887, 8621248, 9516974		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	31287555, 33871399, 37373242	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Stem Neoplasms	Brain Stem Neoplasms	CTD_human_DG	24098593		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Stem Neoplasms, Primary	Brain Stem Neoplasms	CTD_human_DG	24098593		★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11023200, 15450420, 16413469, 20736297, 22485147, 23336272, 25002028, 25006666, 25731732, 25876993, 25991817, 26416047, 26540629, 26658964, 26896604, 26923330, 27017286, 27186656, 27336726, 27634906, 27649142, 27748766, 27759034, 27849562, 27986713, 28042706, 28067227, 28168755, 28203301, 28249908, 28270497, 28395543, 28438180, 28454587, 28560460, 28706010, 28758424, 28801307, 28813415, 28819400, 28872469, 28947133, 28961554, 29027483, 29188531, 29218622, 29232554, 29234248, 29234249, 29236940, 29330290, 29335521, 29392622, 29452249, 29470723, 29483214, 29497278, 29522364, 29527939, 29539425, 29581135, 29685881, 29731395, 29846081, 29847850, 29868122, 29933034, 29935900, 29935901, 29963233, 30038670, 30079740, 30099886, 30103095, 30143968, 30185666, 30202447, 30288929, 30343527, 30359883, 30360668, 30382095, 30389903, 30401694, 30478914, 30479671, 30508677, 30513476, 30520756, 30522347, 30537512, 30559257, 30619511, 30631751, 30662797, 30692100, 30745839, 30806829, 30840889, 30847853, 30959874, 31101994, 31329454, 31358432, 31395685, 31399935, 31448056, 31451564, 31481582, 31544588, 31594766, 31609762, 31610139, 31632494, 31671026, 31709685, 31777590, 31780379, 31798393, 7889533, 9916925		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10480344, 12509456, 19035289, 19874578, 20179208, 20736297, 23336272, 23776583, 23839043, 24124558, 24194916, 24444383, 24608573, 24848372, 25006666, 25927147, 26534844, 27336726, 27748766, 27759034, 28270497, 28370734, 28525384, 28566333, 28794284, 29162134, 29236940, 29581135, 29669860, 30206110, 30343527, 30867218, 31078043, 31522348, 31548560, 31603118, 32028173, 32053082, 32242058, 32344635, 32377705, 32426802, 32657779, 32860163, 32958578, 32998962, 33193348, 33213401, 33264486, 33504001, 33757987, 33789967, 34016182, 34159748, 34244855, 34508104, 34544752, 34712959, 34739066, 35053185, 35121623, 35184131, 35201661, 35220309, 35254385, 35383130, 35395071, 36071033, 36477027, 36693175, 36770598, 36826152, 36892847, 36915230, 36946994, 37330596, 37486454, 37488191, 37633306, 37673211, 37801505, 37854019, 37914699, 38198023, 38403110, 8622677, 9407125, 9528753, 9916925	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32404308, 33536276, 36859416, 37141549, 37143728, 37289194, 37343321, 40141282	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	24194916	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	18503581, 30617194		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10480344, 19237565, 22094256, 24386425, 24751144, 32102537	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21668989	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	26008974	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10937049, 11078762, 11299766, 11788907, 17072968, 17139501, 18484097, 27662657, 27748766, 29522364, 8811128, 8821952, 9738978		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	12376462, 14522882		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	18371186, 31891587, 34312479	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	32319607	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26554657	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11870547, 15298730, 23544130, 23894465, 24931142, 27849562, 28333141, 28453226, 28742201, 28975985, 29225033, 30903681, 31747859, 32306906, 32369692, 33686022, 33960941, 34784846, 34959221, 35193513, 35694386, 35941537, 36292719, 36347033, 36403263, 36617978, 36901767, 37006050, 37870748	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11971182, 14508527, 18361427, 23276138, 25348738, 26318986, 30242024, 31190856, 31331377		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15543620, 15604268, 21477379, 23010077, 24505359, 25668024, 27815686, 30352682, 30546837, 31043741		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33947352	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22869556, 25156567, 26530532, 36346366, 36719686, 37105116	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18948595, 19473483, 23951092, 26036633, 30032137, 31259714, 33215419, 33932757, 34331411, 35368029, 36890610, 40186141	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	15161057	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10498902		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15505422, 19126650, 24604117, 28243976, 28259910, 28778953, 30718506		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462, 14522882		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	LHGDN	12565795		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31312360		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	33885378	Associate	★☆☆☆☆ Found in Text Mining only
Carnevale syndrome	Carnevale syndrome	Pubtator	7592643	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	31079218		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	39437014	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	10325446		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	40629591	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21617218, 23255846, 29048616		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	10329038, 11311493, 21617218, 23255846, 29048616		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11426564, 29995568, 9355972		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21325289		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	27012813, 28637687		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22972485	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31843982, 8760583		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	21777578		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	21777578		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	11332612, 16779802, 18624751, 29123414, 30808351, 9703873		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	11332612, 16779802, 18624751	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	29194728		★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	29194728, 30322893	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15902296, 20713460, 29115462, 29516674		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16108056, 23010077, 29061672, 30462152, 9108461		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19542220, 32727450, 37845228	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14562378, 17072968, 19531654, 22753261, 23530816, 25982393, 26369631, 27167191, 27936934, 28459468, 28560460, 28822989, 29061672, 29288563, 29552187, 30513513		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12676582, 14562378, 17072968, 18931700, 19549253, 22773039, 24292678, 25982393, 28486050, 29512788, 30513513, 30658502, 31040202, 32737302, 33878735, 34120619, 34297714, 34686682, 35913398, 37326340, 37950153	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17072968		★☆☆☆☆ Found in Text Mining only
Compensatory Hyperinsulinemia	Compensatory Hyperinsulinemia	BEFREE	18678431		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	26313366, 31077409		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21304051, 23951092, 29221116, 31575731		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36538237	Associate	★☆☆☆☆ Found in Text Mining only
Costello syndrome (disorder)	Costello syndrome	BEFREE	21880723		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	10861313, 10874641, 10922411, 12844286, 16174859, 20132244, 21801156, 23174022, 23384855, 25026000, 25787093, 25803691, 27473757		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	23316069	Associate	★☆☆☆☆ Found in Text Mining only
Dedifferentiated liposarcoma	Dedifferentiated Liposarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	25852058		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	25852058		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27251476	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15821902, 18678431, 30462152		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15821902, 18678431, 30462152		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12908544, 15298346		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15821902, 19634152, 19695727, 30176239		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Foot	Diabetic foot	Pubtator	37985432	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28620137	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	29904623, 30254491, 31060906		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10803523, 16704435, 26475621, 28989285		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	31451564		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	31451564		★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	23567489	Associate	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	12115352, 23384855		★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	LHGDN	15024701		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	24551291		★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	18624751		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	35121623	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	15474160		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10682682, 14648178, 16293976, 24296733, 29232554		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	10682682		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	10682682	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10682682, 24296733, 26554657	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	28720098	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30925413		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28778953		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29115564, 30563933, 31171890		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27323123, 29115564, 31171890, 35538026, 35937565	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29115564, 30563933, 31171890		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10390005, 33789967, 34148879, 37173384	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	26337082, 27286459, 29262551, 30131386, 30397176, 31737208, 7738717		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	9393981		★☆☆☆☆ Found in Text Mining only
Familial Atypical Mole Melanoma Syndrome	Atypical Mole Melanoma Syndrome	ORPHANET_DG	19585149		★☆☆☆☆ Found in Text Mining only
Familial melanoma	Melanoma	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	21593195, 29245989, 30718927		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	33376220	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30089269		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	21030860		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27894668		★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	18371186		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16166437, 18438954, 19509155		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	29451912, 31553483	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	11358847		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	25852058		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10667596, 12175345, 16150119, 16319692, 16568472, 19141386, 21642372, 22157621, 22711607, 23707559, 23761023, 26180082, 27932423, 27936934, 28368413, 28814434, 28903422, 28952134, 29508248, 29844123, 29921698, 30957234, 31285369, 31307887, 31399936, 31787897, 7987821, 8586464, 8806696, 8811128, 9600204, 9772286		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11351043, 15494095, 19458076, 20406234, 22450747, 23707559, 23737970, 25695927, 26863628, 27932423, 28960623, 28976058, 28993509, 30151703, 31285369, 31399936, 33142244, 34608482, 35075231, 35441887, 35814563, 36055049, 36476408, 36769158, 36920905, 37373242	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10884881, 17002787, 19141386, 21642372, 22157621, 22711607, 23707559, 23761023, 26180082, 27932423, 27936934, 28368413, 28814434, 28903422, 28952134, 28993509, 29247857, 29508248, 29844123, 29921698, 30470262, 30957234, 31307887, 31399936, 31787897, 8811128		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10797439, 21455311, 22825724, 23761023, 26722455, 28717243, 7478535, 7585516, 7728764, 7954404, 8649864, 8847566, 9815774		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21843312, 22450747, 28415661, 28717243, 29016839, 29272522, 32748499, 34959221, 35991838, 36031351, 37524847, 40715243, 9284834, 9804374	Associate	★☆☆☆☆ Found in Text Mining only
gliosarcoma	Gliosarcoma	BEFREE	10666371		★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	10666371	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	29408328		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	26129688	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	32026294	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	8628020, 9031081		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	7632963		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	38621503	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21628965		★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	21412176		★☆☆☆☆ Found in Text Mining only
Hereditary Melanoma	Hereditary cutaneous melanoma	BEFREE	11243640, 11726500, 11828258, 12789279, 16462187, 17505264, 17909018, 18025917, 21085193, 21801156, 26650572, 28146043, 29774366, 30414346, 8710906, 9036865, 9258659, 9425228, 9712735		★☆☆☆☆ Found in Text Mining only
Hereditary Melanoma	Hereditary cutaneous melanoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Hereditary Melanoma	Hereditary cutaneous melanoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	18503581		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12401721, 29108713		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	24708911		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	11438484		★☆☆☆☆ Found in Text Mining only
Hypopituitarism	Hypopituitarism	BEFREE	19283075		★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	18344372	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10471034, 27793037	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28978620	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35538026	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	30252584, 30382607		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	23530816		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	30084835		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31801948		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	10797439, 11704835, 12375265		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	23981302, 35368029, 37047552, 37528416	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	LHGDN	15024701		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12731669, 28286417, 7630199, 7632963, 7919362, 9031081		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21536647, 31761618	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25844667, 30381403, 34103301	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25487917, 25744718, 25844667, 27323399, 28168755, 30381403, 31612739, 9816079		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	28418845, 29108713, 29470723, 30520756		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	12543805, 14672406, 24982332		★☆☆☆☆ Found in Text Mining only
Lipoblastoma	Lipoblastoma	BEFREE	26514741		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	10727978, 10755400, 24965044, 27020493		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	15154619, 31387607	Associate	★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	10755400, 24965044, 27020493		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	10755400, 15154619, 18820664, 19734852, 20601955, 21038090, 23569312, 23832711, 24227706, 24457460, 24965044, 25121597, 26336885, 28099935, 29610390, 29748845, 30420727, 31387607, 33115433, 36464833, 37205634, 37875500, 38621503, 40540926, 7592643	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
liposarcoma	Liposarcoma	BEFREE	14694526, 16938516, 17214366, 19626636, 19734852, 21117066, 21910158, 23393200, 25121597, 25679065, 25810375, 26418953, 31798393, 7592643, 9713346		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
liposarcoma	Liposarcoma	CTD_human_DG	20601955, 23569312		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
liposarcoma	Liposarcoma	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	12640106, 15221942, 16160477, 16489442, 16938516, 17895748, 18214854, 19454362, 19664496, 19737942, 20588177, 21910158, 23393200, 23852861, 24065146, 24227706, 24457460, 25679065, 26336885, 26509911, 27597521, 27778364, 28099935, 28629371, 29153098, 29372852, 30382607, 30420727, 30793229, 30852045, 31145104, 31160689, 31782160		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	CTD_human_DG	20601955, 23569312		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	26514741, 30793229		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Pleomorphic	liposarcoma	CTD_human_DG	20601955, 23569312		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Pleomorphic	liposarcoma	BEFREE	24227706, 26542423, 27778364		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	10755400, 14694526, 16938516, 18160213, 18551309, 21358383, 23852861, 24965044, 25121597, 25679065, 26336885, 26514741, 26542423, 26843318, 27597521, 27879515, 28099935, 31160689		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	CTD_human_DG	20601955, 23569312		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12531694, 12601350		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12845670, 15349907, 16010434, 16317707, 17546056, 20100483, 22429965, 23544130, 23894465, 27708221, 28453226, 28975985, 29225033, 29247039, 29477843, 29923236, 30342168, 30660839, 30810974, 31250364, 31747859, 8760583		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	26189965		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20100483		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15543620		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21477379	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26390342, 28800319, 29306194, 30002440, 33148075, 34138895, 37452037, 38066711, 38579012	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21477379	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24386425	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10803523, 11291051, 12036888, 24614102, 25082755, 29115462, 29232554, 8628020, 9031081		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12036888, 23676220, 25082755, 36402300	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	24913233		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 1	Lymphoma	BEFREE	28989285		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28989285		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Cleaved-Cell, Follicular	Lymphoma	BEFREE	28989285		★☆☆☆☆ Found in Text Mining only
Malignant Cystosarcoma Phyllodes	Cystosarcoma Phyllodes	BEFREE	26542423, 26843318, 29372852		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	12640106, 15041220, 23393200		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	21843312, 8912848, 9916925		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	15781632, 30180865, 30701029		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	16690963		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	7630635		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	31600301, 8847566		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11023200, 16413469, 19874578, 20736297, 22049316, 22485147, 23336272, 25002028, 25006666, 25731732, 25876993, 25991817, 26416047, 26512919, 26540629, 26658964, 26857361, 26896604, 26923330, 27017286, 27186656, 27336726, 27634906, 27649142, 27748766, 27759034, 27849562, 27986713, 28042706, 28067227, 28168755, 28203301, 28249908, 28270497, 28395543, 28438180, 28454587, 28560460, 28706010, 28758424, 28801307, 28813415, 28819400, 28872469, 28947133, 28961554, 29027483, 29188531, 29218622, 29228296, 29232554, 29234248, 29234249, 29236940, 29263697, 29330290, 29335521, 29392622, 29452249, 29470723, 29483214, 29497278, 29522364, 29527939, 29539425, 29564743, 29581135, 29670090, 29685881, 29731395, 29846081, 29847850, 29868122, 29933034, 29935900, 29935901, 29963233, 30038670, 30054831, 30078354, 30079740, 30099886, 30103095, 30143968, 30185666, 30202447, 30288929, 30343527, 30359883, 30360668, 30382095, 30389903, 30401694, 30478914, 30479671, 30508677, 30513476, 30520756, 30522347, 30537512, 30559257, 30619511, 30631751, 30662797, 30692100, 30745839, 30806829, 30840889, 30847853, 30959874, 31101994, 31329454, 31358432, 31395685, 31399935, 31448056, 31451564, 31456944, 31481582, 31544588, 31594766, 31609762, 31610139, 31632494, 31671026, 31709685, 31777590, 31780379, 31798393, 9916925		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10682682, 14648178, 24296733, 29232554		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	11023200, 29115564, 30563933, 31171890		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	8760583		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15543620, 15604268, 21477379, 23010077, 24505359, 25668024, 27815686, 30352682, 30546837, 31043741		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	12543805, 14672406, 24982332		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11733961, 15505422, 24604117, 26043844, 28243976, 28259910, 28888575, 30718506		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10861313, 11807902, 17047042, 17304504, 19639215, 21507037, 22532602, 24986516, 25156567, 29080858, 30254182, 30271501, 30696953, 31745297, 9219065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19017637, 19286570, 27753448, 28209757, 29844131		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	11078762, 29956794		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21628965		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28670390, 28718369, 29104635, 29789536, 30592290, 31026069		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29306020, 30699064		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11971182, 14508527, 18361427, 23276138, 25348738, 26318986, 30242024, 31190856, 31331377		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10359140, 10634406, 11325039, 11567230, 11726500, 11756559, 11986936, 14648178, 15138605, 15208653, 16413464, 17525529, 19001083, 19091943, 19147556, 19327170, 19634152, 21617218, 21668989, 21777578, 22450747, 22718837, 23530816, 23948297, 24045179, 24479804, 24771220, 25082755, 25135429, 25680902, 25695927, 25744718, 26043844, 26658964, 27017286, 27206849, 27237051, 27255164, 27759034, 28044938, 28067227, 28249908, 28303264, 28349562, 28351928, 28403773, 28438180, 28446688, 28526299, 28560460, 28607489, 28637687, 28795589, 28800675, 28801307, 28813415, 28814434, 28888575, 28947133, 28978620, 29024631, 29059158, 29061672, 29086897, 29121869, 29153893, 29160310, 29218622, 29232554, 29298515, 29311118, 29399694, 29408328, 29416931, 29483206, 29496664, 29518312, 29644000, 29739788, 29789718, 29793947, 29844123, 29969496, 29991605, 30038670, 30061045, 30115629, 30536727, 30607633, 30665142, 30677445, 30701428, 30745839, 30758029, 30808351, 30833542, 30897229, 30899002, 31124078, 31200237, 31270456, 31307887, 31395606, 31395685, 31506466, 31567591, 31632494, 31647925, 31652270, 31666930, 7640224, 7705923, 8946202, 9417860, 9563903, 9824096		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	21325289, 23321323, 26528855, 26740486, 30722027		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	28042706		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21617218, 23255846, 29048616		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12676582, 16108056, 23010077, 29061672, 30462152, 9108461		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15208653, 16413469		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27759034, 28067227, 28566333, 28947133		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	15781632, 16690963, 22592113, 26022239, 30180865, 30424705, 30692121, 30701029		★☆☆☆☆ Found in Text Mining only
Medullary Neoplasms	Medullary Neoplasms	CTD_human_DG	24098593		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	27012813, 28637687		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	22583682		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10380935, 10398427, 10596908, 10630172, 10732752, 10777219, 10922411, 10987867, 11325039, 11479422, 11511314, 11556834, 11595726, 11756559, 11807902, 11828258, 11900878, 12115352, 12497626, 12731669, 12789281, 12844286, 12904177, 14646620, 14735200, 15547691, 15577313, 15860862, 15880589, 15951821, 16291983, 16419059, 16759158, 17047042, 17505264, 17909018, 18023021, 18025917, 18386818, 18790768, 19011513, 19238106, 19320745, 19585149, 20132244, 20629968, 20649939, 20653773, 21507037, 21801156, 22621339, 22978401, 23174022, 23355370, 23384855, 23538902, 23543365, 23546221, 24019069, 24089445, 24258989, 24495407, 25189354, 25431349, 25588041, 25687217, 25796376, 25803691, 26110554, 26477315, 26808500, 26810603, 26988987, 26999380, 27017286, 27473757, 27806323, 28039358, 28092667, 28114255, 28192409, 28463841, 28526299, 28530267, 28553955, 28830923, 28870692, 29121869, 29243224, 29347968, 29496664, 29541385, 29716938, 30219673, 30388455, 30405888, 30414346, 30631751, 30782616, 30819666, 30858922, 31103822, 31320640, 31326397, 31413145, 31439820, 31555743, 31567591, 7652577, 7923152, 8152487, 8611425, 8710906, 8968104, 9036865, 9258659, 9311594, 9328469, 9354451, 9416844, 9425228, 9469357, 9598804, 9712735, 9724087		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10390011, 10727462, 11511314, 11556834, 12115352, 15526363, 15921959, 17218782, 18790768, 20653773, 21085193, 22080950, 22094256, 22978401, 23103111, 23384855, 24162924, 25687217, 26201960, 26810603, 27181379, 27883322, 27903987, 28283772, 28526299, 28870692, 28903138, 29523635, 29774366, 30180747, 30657954, 30792348, 30819666, 30952641, 31320640, 31326397, 31439820, 31555743, 31980996, 32283231, 32488085, 33067454, 33077847, 33322357, 33419898, 33509032, 33910831, 33982545, 36739402, 37379213, 37917641, 37958811, 38066711, 38615585, 8611425, 8710906	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11828258, 15880589, 17505264, 18023021, 18632627, 18803811		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CLINVAR_DG	25157968		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35525274	Stimulate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	10732752, 12844286, 18612309, 21801156, 23103111, 23384855, 25787093, 25803691, 28526299, 33322357, 33910831, 35085295	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma, Amelanotic	Melanoma	BEFREE	19339902		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	9824096		★☆☆☆☆ Found in Text Mining only
Mesencephalic Neoplasms	Mesencephalic Neoplasms	CTD_human_DG	24098593		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11172613, 18383817, 7630635		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	20043850, 28283772, 37298855	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	20043850, 28704762, 32708306	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28526299		★☆☆☆☆ Found in Text Mining only
MICROPHTHALMIA, SYNDROMIC 7	Syndromic microphthalmia	BEFREE	25650275		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	10585280		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	11267947, 24982332, 27031247	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	14672406		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	11135432		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	17664862, 24531709, 29134609		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17897300, 28918692, 29562955, 30463534, 31666930		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29562955, 9207463	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35082402	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	34284104	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	30368521	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	26398525	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	18537972, 26637365, 31761618, 8555065		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	11564876	Associate	★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	18551309, 26514741, 30793229, 9713346		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19430707, 21445878, 24168228, 24751144, 24771220, 25109634, 26383521, 26559153, 26993269, 27451945, 30236142		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	19430707, 24751144, 24771220, 25109634, 26993269, 27451945	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10092131, 10403840, 10634406, 10634644, 10666371, 10797439, 10861313, 10922411, 10943202, 10995450, 11023200, 11078762, 11180160, 11244044, 11311493, 11325039, 11358847, 11470742, 11515790, 11704835, 11726500, 11756559, 12112531, 12357246, 12375265, 12731669, 12861061, 14646620, 14648178, 15138605, 15161057, 15221942, 15314163, 15317660, 15475449, 15492825, 15543620, 15547691, 15735978, 15781632, 16108056, 16160477, 16319987, 16413464, 16707471, 16969111, 16984623, 17139501, 17664862, 17804741, 17895748, 18036404, 18172308, 18760195, 18978177, 19125298, 19147556, 19208363, 19327170, 19411068, 19531654, 19549253, 19634152, 19737942, 20423997, 20522552, 20609353, 20651055, 20951943, 21030860, 21423208, 21642372, 21750653, 21910158, 22108090, 22209285, 22322893, 22711607, 22749040, 22761470, 22815924, 23318451, 23336272, 23792647, 23979958, 24046371, 24089445, 24168228, 24300090, 24496383, 24531709, 24614102, 24751144, 24771220, 24922675, 24965044, 25002028, 25059573, 25189354, 25810375, 26183925, 26369631, 26528855, 26540629, 26943575, 27017286, 27049724, 27167191, 27181366, 27206849, 27286459, 27440272, 27472462, 27597521, 27708221, 27759034, 27806323, 28039358, 28039467, 28044938, 28169543, 28177473, 28418845, 28566333, 28580868, 28604107, 28607489, 28653662, 28801307, 28813415, 28830923, 28915557, 28961193, 29101163, 29147869, 29236940, 29247039, 29371946, 29483206, 29497091, 29539425, 29564743, 29617654, 29689276, 29807045, 29844131, 29905536, 29934327, 29963233, 29996110, 30105234, 30130984, 30165341, 30287548, 30382607, 30537512, 30562012, 30655702, 30660839, 30662797, 30699064, 30700828, 30701029, 30714150, 30718512, 30724426, 30745839, 30772267, 30782616, 30784916, 30858922, 30899002, 30979737, 31039152, 31101835, 31302234, 31318440, 31326397, 31329050, 31331377, 31358010, 31369120, 31387607, 31395606, 31399936, 31413145, 31424939, 31439820, 31444334, 31535356, 31548560, 31591187, 31634336, 31692039, 31745297, 31780379, 7478563, 7585516, 7630199, 7632963, 7640224, 7652577, 7705923, 7889533, 8012957, 8586464, 8611425, 8621224, 8621248, 8635161, 8668350, 8751388, 8811128, 8847566, 9166859, 9194486, 9219065, 9231912, 9284834, 9284835, 9311594, 9355981, 9405679, 9563903, 9600204, 9665476, 9667525, 9685701, 9712735, 9723034, 9815774, 9935200		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	28637687		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	15797629		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10203608, 18413728, 23462184, 24045179, 25810375, 27729458, 27986745, 28604107, 31756773, 9935245		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	17273780, 18413728, 23462184, 25377796, 34893606, 35859155, 36982482, 37169874, 38019470	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	19147556, 8847566		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	22761470, 28226315, 28991877		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	26740486		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	26740486		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	26740486		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	30104415	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	28418845, 29108713, 29470723, 30520756		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	22583682		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30089269		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11788907, 17804741, 20609353, 24454854, 24496383, 26744345, 26802652, 26840018, 27049724, 27166267, 27431575, 28260088, 28866094, 29024631, 29311118, 29716919, 29935356, 30167080, 30647837, 30718506, 31119047, 31190865, 31199581, 31395685, 31586771, 9414664		★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	BEFREE	30135075		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18678431, 19327170, 19634152		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	19327170	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	23103111	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	26896604, 28249908, 28395543, 28418845, 28529550, 28626036, 28653662, 29059158, 29236235, 29483206, 29497091, 29669860, 29784737, 29934327, 30206110, 30389903, 30772267, 30914635, 31439820, 31690650		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	11764090		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	18544654	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27391794		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10101594, 10502725, 10817503, 10943202, 20196171, 21336260, 22301501, 22749040, 24835790, 25680902, 28560411, 29268950, 29452249, 29905536, 31154837, 9665476, 9703873, 9935200		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	11152455, 20601938, 21336260, 24835790, 29452249, 31974626, 32026294, 33963544, 34008925, 36031605, 37931683	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15505422, 24604117, 28259910		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	28039467	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18202766		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24604117, 28243976, 30718506		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21278246, 21502498, 23114871, 23345014, 24604117, 28259910, 28508842	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10861313, 11325039, 11807902, 17047042, 17304504, 19639215, 21507037, 22532602, 25156567, 29080858, 30254182, 30271501, 30696953, 31745297, 9219065, 9667525		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22869556		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22162652, 22869556, 28283772, 36346366	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29156680, 30391671		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	11756559		★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	31535356		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	25156567, 29080858		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	37453150	Associate	★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	21030860		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	12940460	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	25234309		★☆☆☆☆ Found in Text Mining only
Pontine Tumors	Pontine Tumors	CTD_human_DG	24098593		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28983608		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	29408328		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	27341130, 29408328		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	11118035, 19318552, 28007775, 28151717, 30701029		★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10640976, 19017637, 19286570, 27753448, 28209757, 29844131, 31566058		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19017637, 21867506, 23684928, 26129688, 29767250, 31060254, 33522043, 34863188, 35121110	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28209757		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31145809		★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	16504044		★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	20932960		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21304051, 23951092, 29221116, 30372389		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10493518, 10587703, 10665922, 10732752, 10817503, 10962575, 11243864, 12148857, 12401721, 12543805, 12657672, 12940460, 15161057, 16613540, 17456787, 17487385, 17599043, 17804741, 18484097, 19095153, 19147556, 19286570, 20100483, 22157621, 25738322, 26043844, 26318986, 26369631, 27466490, 27634906, 27849562, 28444744, 28446612, 28741274, 28869970, 28961193, 29016839, 29109039, 29232554, 29261702, 29263697, 29288563, 29357250, 29386107, 29452249, 29483206, 29564743, 29739788, 29789630, 29963233, 29995568, 30032137, 30151703, 30254491, 30343527, 30463534, 30519351, 30598078, 30718512, 30808351, 30959874, 31043741, 31231312, 31490285, 31629614, 31787897, 31831640, 31832685, 7630199, 7705923, 7834618, 7936665, 8570224, 8934552, 9194486, 9302564, 9341929, 9703873, 9861348		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	16051300, 24046371, 29016839, 29236940, 31832685, 36005200, 36399634	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	36859416	Inhibit	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	21666498, 28432176		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	21871868	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15024701, 19235922, 25810375, 26199390, 8221695		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	24406431	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	23469153, 24551291, 37315267	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Embryonal	Rhabdomyosarcoma	Pubtator	24551291	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16802342		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	26247885	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	10943202, 11376805, 11564577, 16160477, 22387046, 22982072, 26528855, 27597521, 28404587, 28460268, 28619757, 29670090, 31160689, 7640224, 8221695, 8527390, 8946207, 9315096, 9563903, 9582521, 9916925		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26943575, 28099935, 29801054, 30206211, 32047232, 32885893, 34302054, 34939467, 37875500, 39778225, 7592643, 9562620	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	36495678	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	27334220, 29670090, 33495604	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18322470, 27216283		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	11291051		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	26336885	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	33509032	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	14647432		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	38410032	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29088741, 30718512, 31504118		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	36399634, 40696621	Associate	★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	16160477, 25679065, 7656201, 9703873		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	9916925		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10235368, 11854066, 12357246, 17139501, 17340131, 28042706		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28059068, 28444744, 28578693, 30899002, 31205550, 8012957		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24386425, 24982332, 27311401, 28108672, 29073835, 30949979, 33495400, 35546399, 36700826, 36768994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30093452, 30700828, 31516564		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	14586645, 24982332, 27815686, 28042706, 30711949, 30941307, 30986809, 31727874, 7542912		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	29464035		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29024678		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30089269		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28670390, 28718369, 29104635, 29789536, 30592290, 30714150, 31026069		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21628965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	22359486, 26735582, 27077843, 28718369, 29789536, 30592290, 32373958, 34686196, 35535229, 35880418, 35936358, 37794689, 40138292	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	BEFREE	28699811, 29108713		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	29670090		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	19001083		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	15161057		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	12904177		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	28179162		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	18799615, 29306020, 30699064		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31766881	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27440272, 29306020, 30699064		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18799615, 34972706, 35968508, 37964967	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	24531709		★☆☆☆☆ Found in Text Mining only
Triglyceride storage disease with ichthyosis	Triglyceride Storage Disease With Ichthyosis	BEFREE	28404587		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22733811, 22751436, 27759034, 28067227, 28606920, 28947417, 29261702, 29617654, 30504427, 30607633, 31101835, 31253784, 31591311, 31610139		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27759034, 33599863, 33832512, 35236318, 35817775	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	10634406		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	31522348, 38066711	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	31522348		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	23567489		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	23567489	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462, 14522882		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22289176, 25348738, 32102537, 33452764, 35062876	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23255846, 24046371	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	17047042, 20842456, 21412176		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	26810603	Associate	★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29441600		★☆☆☆☆ Found in Text Mining only
Vascular Neoplasms	Vascular neoplasm	BEFREE	30382607		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	29149451		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	11764090		★☆☆☆☆ Found in Text Mining only
Well-differentiated liposarcoma	Liposarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	11078762		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	30146633		★☆☆☆☆ Found in Text Mining only