CDK3 (cyclin dependent kinase 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1018
• Gene name: Cyclin dependent kinase 3
• Gene symbol: CDK3
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q25.1
• Summary: This gene encodes a member of the cyclin-dependent protein kinase family. The protein promotes entry into S phase, in part by activating members of the E2F family of transcription factors. The protein also associates with cyclin C and phosphorylates the r

miRNA Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053431	hsa-miR-512-5p	Microarray	23807165
MIRT731162	hsa-miR-873-5p	5.0	25531331
MIRT731162	hsa-miR-873-5p	5.0	25531331
MIRT881138	hsa-miR-1302	CLIP-seq
MIRT881139	hsa-miR-3122	CLIP-seq
MIRT881140	hsa-miR-3199	CLIP-seq
MIRT881141	hsa-miR-3545-3p	CLIP-seq
MIRT881142	hsa-miR-3646	CLIP-seq
MIRT881143	hsa-miR-3913-5p	CLIP-seq
MIRT881144	hsa-miR-4298	CLIP-seq
MIRT881145	hsa-miR-4539	CLIP-seq
MIRT881146	hsa-miR-4724-5p	CLIP-seq
MIRT881147	hsa-miR-4740-5p	CLIP-seq
MIRT1961005	hsa-miR-1292	CLIP-seq
MIRT1961006	hsa-miR-1343	CLIP-seq
MIRT1961007	hsa-miR-1976	CLIP-seq
MIRT1961008	hsa-miR-4267	CLIP-seq
MIRT1961009	hsa-miR-450b-3p	CLIP-seq
MIRT1961010	hsa-miR-4713-3p	CLIP-seq
MIRT1961011	hsa-miR-638	CLIP-seq
MIRT1961012	hsa-miR-769-3p	CLIP-seq
MIRT1961005	hsa-miR-1292	CLIP-seq
MIRT1961006	hsa-miR-1343	CLIP-seq
MIRT1961007	hsa-miR-1976	CLIP-seq
MIRT1961008	hsa-miR-4267	CLIP-seq
MIRT1961009	hsa-miR-450b-3p	CLIP-seq
MIRT1961010	hsa-miR-4713-3p	CLIP-seq
MIRT1961011	hsa-miR-638	CLIP-seq
MIRT1961012	hsa-miR-769-3p	CLIP-seq
MIRT2385859	hsa-miR-1207-3p	CLIP-seq
MIRT2385860	hsa-miR-1827	CLIP-seq
MIRT2385861	hsa-miR-3612	CLIP-seq
MIRT2385862	hsa-miR-4731-5p	CLIP-seq
MIRT2385863	hsa-miR-486-3p	CLIP-seq
MIRT2385864	hsa-miR-646	CLIP-seq
MIRT2385865	hsa-miR-650	CLIP-seq

Gene ontology (GO) Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	8846921
GO:0000166	Function	Nucleotide binding	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IPI	15084261
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IBA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	TAS	1639063
GO:0005515	Function	Protein binding	IPI	9840943, 15084261, 22939624, 23602568, 24218572, 25344755, 28514442, 32296183, 33961781, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0006974	Process	DNA damage response	IDA	24550317
GO:0007165	Process	Signal transduction	IBA
GO:0008283	Process	Cell population proliferation	TAS	1639063, 18794154
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	IBA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030332	Function	Cyclin binding	IBA
GO:0045023	Process	G0 to G1 transition	IDA	15084261
GO:0045023	Process	G0 to G1 transition	TAS	15084261
GO:0045746	Process	Negative regulation of Notch signaling pathway	IDA	25344755
GO:0051301	Process	Cell division	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 123828
• HGNC: 1772
• e!Ensembl: ENSG00000250506

Protein

• UniProt ID: Q00526
• Protein name: Cyclin-dependent kinase 3 (EC 2.7.11.22) (Cell division protein kinase 3)
• Protein function: Serine/threonine-protein kinase that plays a critical role in the control of the eukaryotic cell cycle; involved in G0-G1 and G1-S cell cycle transitions. Interacts with CCNC/cyclin-C during interphase. Phosphorylates histone H1, ATF1, RB1 and C
• PDB: 7XQK , 8H4R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	4 → 286	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in cancer cell lines and glioblastoma tissue. {ECO:0000269|PubMed:18794154}.
• Sequence:

  MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
  PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS
  HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY
  TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF
  PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL
  QRFRH

• Sequence length: 305

Related Genes

No strongly related genes found yet for CDK3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CDK3.