CDK11A (cyclin dependent kinase 11A)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 728642
• Gene name: Cyclin dependent kinase 11A
• Gene symbol: CDK11A
• Synonyms (NCBI Gene): CDC2L2, CDC2L3, CDK11-p110, CDK11-p46, CDK11-p58, PITSLRE, p58GTA
• Chromosome: 1
• Chromosome location: 1p36.33
• Summary: This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighb

miRNA Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049054	hsa-miR-92a-3p	CLASH	23622248
MIRT037092	hsa-miR-877-3p	CLASH	23622248
MIRT440966	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440966	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT880235	hsa-miR-4256	CLIP-seq
MIRT880236	hsa-miR-4281	CLIP-seq
MIRT880237	hsa-miR-4449	CLIP-seq
MIRT880238	hsa-miR-4682	CLIP-seq
MIRT880239	hsa-miR-4713-5p	CLIP-seq
MIRT880240	hsa-miR-4714-5p	CLIP-seq
MIRT880241	hsa-miR-615-5p	CLIP-seq
MIRT2197448	hsa-miR-3973	CLIP-seq
MIRT2197449	hsa-miR-548a-5p	CLIP-seq
MIRT2197450	hsa-miR-548ab	CLIP-seq
MIRT2197451	hsa-miR-548ak	CLIP-seq
MIRT2197452	hsa-miR-548b-5p	CLIP-seq
MIRT2197453	hsa-miR-548c-5p	CLIP-seq
MIRT2197454	hsa-miR-548d-5p	CLIP-seq
MIRT2197455	hsa-miR-548h	CLIP-seq
MIRT2197456	hsa-miR-548i	CLIP-seq
MIRT2197457	hsa-miR-548j	CLIP-seq
MIRT2197458	hsa-miR-548w	CLIP-seq
MIRT2197459	hsa-miR-548y	CLIP-seq
MIRT2197460	hsa-miR-559	CLIP-seq

Gene ontology (GO) Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	NAS	1639388
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IPI	18216018
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001558	Process	Regulation of cell growth	IEP	10882096
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	NAS	9750192
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	12501247
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004693	Function	Cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	22939624, 23178491, 33961781
GO:0005524	Function	ATP binding	IDA	12501247
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8195233
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	9750192
GO:0006468	Process	Protein phosphorylation	IDA	12501247
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	NAS	9750192
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0042981	Process	Regulation of apoptotic process	NAS	17516030
GO:0043484	Process	Regulation of RNA splicing	IDA	12501247, 18216018
GO:0046605	Process	Regulation of centrosome cycle	NAS	24436071
GO:0050684	Process	Regulation of mRNA processing	IDA	12501247
GO:0050684	Process	Regulation of mRNA processing	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	NAS	2217177
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 116951
• HGNC: 1730
• e!Ensembl: ENSG00000008128

Protein

• UniProt ID: Q9UQ88
• Protein name: Cyclin-dependent kinase 11A (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 2) (Cell division protein kinase 11A) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L2)
• Protein function: Appears to play multiple roles in cell cycle progression, cytokinesis and apoptosis. The p110 isoforms have been suggested to be involved in pre-mRNA splicing, potentially by phosphorylating the splicing protein SFRS7. The p58 isoform may act as
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	426 → 711	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed ubiquitously. Some evidence of isoform-specific tissue distribution. {ECO:0000269|PubMed:8195233, ECO:0000269|PubMed:9750192}.
• Sequence:

  MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHCMEI
  TIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKWKHARVKEREHE
  RRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQK
  ERERRAEERRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPRPPRERFELGDGRKPG
  EARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEE
  EEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSEDEERENENHLLVV
  PESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALLPIELKQELPKYLPALQGC
  RSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKA
  QHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKH
  LHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGA
  KEYSTAVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKELGTPSEKIWPGYSELPVVK
  KMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDP
  SMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFS
  LKF

• Sequence length: 783

Pathways

Reactome Pathway:

Recruitment of mitotic centrosome proteins and complexes

Related Genes

No strongly related genes found yet for CDK11A.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to CDK11A.