CDIP1 (cell death inducing p53 target 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 29965
Gene name Cell death inducing p53 target 1
Gene symbol CDIP1
Synonyms (NCBI Gene)
C16orf5CDIPI1LITAFL
Chromosome 16
Chromosome location 16p13.3
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT042826 hsa-miR-324-3p CLASH 23622248
MIRT036009 hsa-miR-1301-3p CLASH 23622248
MIRT737532 hsa-miR-21-5p Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)RNA-seqqRT-PCRFlow cytometry 33391474
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18 Show/Hide all (18)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21516116, 25416956, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 17599062
GO:0005634 Component Nucleus NAS 10570909
GO:0005764 Component Lysosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610503 13234 ENSG00000089486
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H305
Protein name Cell death-inducing p53-target protein 1 (Cell death involved p53-target) (Cell death-inducing protein) (LITAF-like protein) (Lipopolysaccharide-induced tumor necrosis factor-alpha-like protein) (Transmembrane protein I1)
Protein function Acts as an important p53/TP53-apoptotic effector. Regulates TNF-alpha-mediated apoptosis in a p53/TP53-dependent manner.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10601 zf-LITAF-like 135 → 205 LITAF-like zinc ribbon domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain. Expressed at lower level in heart, skeletal muscle, kidney, pancreas and liver. Weakly or not expressed in placenta and lung. {ECO:0000269|PubMed:10570909}.
Sequence 
MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHP
MPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSG
AATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLI
PCLINDFKDVTHTCPSCKAYIYTYKRLC
Sequence length 208
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asthma Asthma BEFREE 24560857
★★★★★
★☆☆☆☆
Found in Text Mining only
Epilepsy Idiopathic Generalized Epilepsy Pubtator 33503978 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Parkinson Disease Parkinson disease Pubtator 35481549 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for CDIP1.

No additional diseases found yet through genes similar to CDIP1.